"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A3P1CAW1"	"{'domain_architectures': 12777, 'entries': 21, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 2, 'cdd': 1, 'pfam': 3, 'smart': 2, 'hamap': 1, 'panther': 1, 'pirsf': 1, 'ncbifam': 1, 'prosite': 1, 'interpro': 7}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 12777}"	"[""DNA repair enzyme that has both DNA N-glycosylase activity and AP-lyase activity. The DNA N-glycosylase activity releases various damaged pyrimidines from DNA by cleaving the N-glycosidic bond, leaving an AP (apurinic/apyrimidinic) site. The AP-lyase activity cleaves the phosphodiester bond 3' to the AP site by a beta-elimination, leaving a 3'-terminal unsaturated sugar and a product with a terminal 5'-phosphate""]"	"nth"	"[{'identifier': 'GO:0003824', 'name': 'catalytic activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006281', 'name': 'DNA repair', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0006284', 'name': 'base-excision repair', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0051539', 'name': '4 iron, 4 sulfur cluster binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003906', 'name': 'DNA-(apurinic or apyrimidinic site) endonuclease activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A0A3P1CAW1_9BACT"	"7689873d5b659f892cce3a9d61a84a789067fc8a"	True	False	217	"Endonuclease III"	3	"UP000274271"	"MLKKERFRHFLDYFTTNFPEPKTELNFRNPYELLVAVILSAQCTDKRINQVTPRLFDRFPEPESLAAASVEEVFSYIRSVSYPNNKAKHLVGMAKVLTEEFGSEVPANVDDLQKMPGVGRKTAHVITSLIFNQPTMAVDTHVFRVSHRLGLVPKTATTPLAVEKALVQYIPNQYVPKAHHWLILHGRYVCIARSPKCSECALTHFCQYYEKLSGTRM"	"unreviewed"	"{'taxId': '2025310', 'scientificName': 'Larkinella knui', 'fullName': 'Larkinella knui'}"
