"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A3B3Z0C9"	"{'domain_architectures': 1371, 'entries': 3, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'panther': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 1371}"	"['Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone']"	""	"[{'identifier': 'GO:0042773', 'name': 'ATP synthesis coupled electron transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005743', 'name': 'mitochondrial inner membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0A3B3Z0C9_9TELE"	"27f5d7c8f342b6447c010867335e240f6d7c0ea5"	True	False	108	"NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7"	3	"UP000261480"	"MATATKIIQRLRNLLAGHDLQSKLQLRYDEIAKRTQPPPKLPVGPSHKFANNYYYTRDGRRESVPATVVMSSQKALTAGSEVAKTTKAPVTPGTVYEPPPLSTDQPYL"	"unreviewed"	"{'taxId': '48701', 'scientificName': 'Poecilia mexicana', 'fullName': 'Poecilia mexicana'}"