"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A3B3IS22"	"{'domain_architectures': 54059, 'entries': 10, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'panther': 1, 'ncbifam': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 54059}"	"['Catalyzes the removal of transit peptides required for the targeting of proteins from the mitochondrial matrix, across the inner membrane, into the inter-membrane space. Known to process the nuclear encoded protein DIABLO']"	"IMMP1L"	"[{'identifier': 'GO:0004252', 'name': 'serine-type endopeptidase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006465', 'name': 'signal peptide processing', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0008236', 'name': 'serine-type peptidase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006508', 'name': 'proteolysis', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0A3B3IS22_HUMAN"	"bb9ee7a24c58ad2ba1f841af5633a4cc11e465a5"	True	False	False	124	"Mitochondrial inner membrane protease subunit"	1	"UP000005640"	"MLRGVLGKTFRLVGYTIQYGCIAHCAFEYVGGVVMCSGPSMEPTIQNSDIVFAENLSRHFYGIQRGDIVIAKSPSDPKSNICKRVIGLEGDKILTTSPSDFFKSHSYTIVIKTCATHPFLSNGS"	"unreviewed"	"{'taxId': '9606', 'scientificName': 'Homo sapiens', 'fullName': 'Homo sapiens (Human)'}"
