"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A340Y8P9"	"{'domain_architectures': 35721, 'entries': 16, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cdd': 2, 'ssf': 1, 'cathgene3d': 1, 'pfam': 2, 'smart': 2, 'panther': 1, 'prosite': 1, 'interpro': 6}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 35721}"	"['Regulatory component of the cyclin D2-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G(1)/S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complex and the subsequent transcription of E2F target genes which are responsible for the progression through the G(1) phase. Hypophosphorylates RB1 in early G(1) phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals']"	"CCND2"	""	"A0A340Y8P9_LIPVE"	"fd1efc4a1ce5c8e2dc0db0172d8c97e704be840e"	True	False	289	"G1/S-specific cyclin-D2"	3	"UP000265300"	"MELLCGEVDPVRRAVPDANLLHDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAINYLDRFLAGVPTPKTHLQLLGAVCMFLASKLKETIPLTAEKLCIYTDNSVKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQPSEKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEDVSSLTGDALVDLLAKITNTDVDCLKACQEQIEVVLLNSLQQYRQDQGDGSKSEDELDQASTPTDVRDIDL"	"unreviewed"	"{'taxId': '118797', 'scientificName': 'Lipotes vexillifer', 'fullName': 'Lipotes vexillifer (Yangtze river dolphin)'}"
