"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A332"	"{'domain_architectures': 15039, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'hamap': 1, 'panther': 1, 'ncbifam': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 15039}"	"['May control the interaction of photosystem II (PSII) cores with the light-harvesting antenna, regulates electron flow through the 2 photosystem reaction centers. PSII is a light-driven water plastoquinone oxidoreductase, using light energy to abstract electrons from H(2)O, generating a proton gradient subsequently used for ATP formation']"	"psbZ"	"[{'identifier': 'GO:0015979', 'name': 'photosynthesis', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0042549', 'name': 'photosystem II stabilization', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0009523', 'name': 'photosystem II', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0009539', 'name': 'photosystem II reaction center', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"PSBZ_COFAR"	"54390648ce66c90ce17cf9e726aea0f412b9057c"	True	False	False	62	"Photosystem II reaction center protein Z"	3	"UP001652660"	"MTLAFQLAVFALIATSSILLISVPVVFASPDGWSSNKNVIFSGTSLWIGLVFLVGILNSLIS"	"reviewed"	"{'taxId': '13443', 'scientificName': 'Coffea arabica', 'fullName': 'Coffea arabica (Arabian coffee)'}"