"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A2U3Z1Z2"	"{'domain_architectures': 27458, 'entries': 11, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cdd': 1, 'ssf': 1, 'pfam': 1, 'cathgene3d': 1, 'panther': 1, 'prosite': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 27458}"	"['Part of the AP-3 complex, an adaptor-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes. In concert with the BLOC-1 complex, AP-3 is required to target cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals']"	"LOC102746656"	"[{'identifier': 'GO:0006896', 'name': 'Golgi to vacuole transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0030123', 'name': 'AP-3 adaptor complex', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0015031', 'name': 'protein transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0006886', 'name': 'intracellular protein transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0016192', 'name': 'vesicle-mediated transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0030117', 'name': 'membrane coat', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0A2U3Z1Z2_LEPWE"	"06d32c800fac36020d03f379936b1bd62ff88561"	True	False	False	193	"AP complex mu/sigma subunit domain-containing protein"	3	"UP000245341"	"MIKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLEGGLLIGGSDNKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHVDKVHNILAKMVMGGMVLETNMNEIVTQIDAQNKLEKSEAGLAGAPARAVSAVKNMNLPEIPRNINIGDISIKVPNLPSFK"	"unreviewed"	"{'taxId': '9713', 'scientificName': 'Leptonychotes weddellii', 'fullName': 'Leptonychotes weddellii (Weddell seal)'}"
