{"metadata":{"accession":"A0A2K5YWQ8","id":"A0A2K5YWQ8_MANLE","source_organism":{"taxId":"9568","scientificName":"Mandrillus leucophaeus","fullName":"Mandrillus leucophaeus (Drill)"},"name":"Natriuretic peptides A","description":["Hormone produced in the kidneys that appears to be important for maintaining cardio-renal homeostasis. Mediates vasodilation, natriuresis and diuresis primarily in the renal system, in order to maintain the extracellular fluid volume and control the fluid-electrolyte balance. Specifically binds and stimulates cGMP production by renal transmembrane receptors, likely NPR1. Urodilatin not ANP, may be the natriuretic peptide responsible for the regulation of sodium and water homeostasis in the kidney","May have a role in cardio-renal homeostasis through regulation of diuresis and inhibiting aldosterone synthesis. In vitro, promotes the production of cGMP and induces vasodilation. May promote natriuresis, at least in part, by enhancing prostaglandin E2 synthesis resulting in the inhibition of renal Na+-K+-ATPase. May have a role in potassium excretion but not sodium excretion (natriuresis). Possibly enhances protein excretion in urine by decreasing proximal tubular protein reabsorption","May have a role in cardio-renal homeostasis through regulation of natriuresis and vasodilation. In vivo promotes natriuresis and in vitro, vasodilates renal artery strips","May have a role in cardio-renal homeostasis through regulation of natriuresis and vasodilation. In vivo promotes natriuresis. In vitro, selectively vasodilates intestinal and vascular smooth muscle strips","May have a role in cardio-renal homeostasis through regulation of natriuresis and vasodilation. In vivo promotes natriuresis. In vitro, selectively vasodilates intestinal smooth muscle but not vascular smooth muscle strips","May have a role in cardio-renal homeostasis through regulation of natriuresis, diuresis, vasodilation, and inhibiting aldosterone synthesis. In vitro, promotes the production of cGMP and induces vasodilation. May promote natriuresis, at least in part, by enhancing prostaglandin E2 synthesis resulting in the inhibition of renal Na+-K+-ATPase. However reports on the involvement of this peptide in mammal blood volume and blood pressure homeostasis are conflicting; according to a report, in vivo it is not sufficient to activate cGMP and does not inhibit collecting duct transport nor effect diuresis and natriuresis. Appears to bind to specific receptors that are distinct from the receptors bound by atrial natriuretic peptide and vessel dilator. Possibly enhances protein excretion in urine by decreasing proximal tubular protein reabsorption","May have a role in cardio-renal homeostasis through regulation of regulation of natriuresis and vasodilation. In vivo promotes natriuresis. In vitro, vasodilates intestinal smooth muscle but not smooth muscle strips"],"length":153,"sequence":"MSSFSTISVSFLLFLAFQLPGQTRANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLREQNEEAGAALSPLPEVPPWTGDVSPAQRDGGALGQGPWDSSDRSALLKSKLRALLTAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRYRR","proteome":"UP000233140","gene":"NPPA","go_terms":[{"identifier":"GO:0005179","name":"hormone activity","category":{"code":"F","name":"molecular_function"}},{"identifier":"GO:0005576","name":"extracellular region","category":{"code":"C","name":"cellular_component"}}],"protein_evidence":3,"source_database":"unreviewed","is_fragment":false,"in_alphafold":true,"in_bfvd":false,"ida_accession":"3766b1f6ec4645054fcaa69d6cf1668779855244","counters":{"domain_architectures":3386,"entries":10,"isoforms":0,"proteomes":1,"sets":0,"structures":0,"taxa":1,"dbEntries":{"smart":1,"panther":1,"pfam":1,"prints":2,"prosite":1,"interpro":4},"proteome":1,"taxonomy":1,"similar_proteins":3386}}}