"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A2K5TTY7"	"{'domain_architectures': 27458, 'entries': 12, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'panther': 1, 'pirsf': 1, 'prosite': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 27458}"	"['Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules']"	"AP1S2"	"[{'identifier': 'GO:0035615', 'name': 'clathrin-cargo adaptor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016192', 'name': 'vesicle-mediated transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0030121', 'name': 'AP-1 adaptor complex', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0015031', 'name': 'protein transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0006886', 'name': 'intracellular protein transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0030117', 'name': 'membrane coat', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0A2K5TTY7_MACFA"	"06d32c800fac36020d03f379936b1bd62ff88561"	True	False	False	153	"AP complex subunit sigma"	3	"UP000233100"	"MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQEPRHEYFNVPVY"	"unreviewed"	"{'taxId': '9541', 'scientificName': 'Macaca fascicularis', 'fullName': 'Macaca fascicularis (Crab-eating macaque)'}"
