"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A2J8SSK1"	"{'domain_architectures': 2387, 'entries': 16, 'isoforms': 0, 'proteomes': 1, 'sets': 3, 'structures': 0, 'taxa': 1, 'dbEntries': {'cdd': 1, 'profile': 1, 'cathgene3d': 3, 'ssf': 2, 'pfam': 2, 'panther': 1, 'interpro': 6}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 2387}"	"['Component of the ESCRT-II complex (endosomal sorting complex required for transport II), which is required for multivesicular body (MVB) formation and sorting of endosomal cargo proteins into MVBs. The MVB pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. The ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex. Its ability to bind ubiquitin probably plays a role in endosomal sorting of ubiquitinated cargo proteins by ESCRT complexes. The ESCRT-II complex may also play a role in transcription regulation, possibly via its interaction with ELL. Binds phosphoinosides such as PtdIns(3,4,5)P3']"	"VPS36"	"[{'identifier': 'GO:0032266', 'name': 'phosphatidylinositol-3-phosphate binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0043130', 'name': 'ubiquitin binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0032509', 'name': 'endosome transport via multivesicular body sorting pathway', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0000814', 'name': 'ESCRT II complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0A2J8SSK1_PONAB"	"6af842596849133deb280acbb1887a3fa7a82d1f"	True	False	False	386	"Vacuolar protein-sorting-associated protein 36"	3	"UP000001595"	"MDRFVWTSGLLEINETLVIQQRGVRIYDGEEKIKFDAGTLLLSTHRLIWRDQKNHECCMAILLSQIVFIEEQAAGIGKSAKIVVHLHPAPPNKEPGPFQSSKNSYIKLSFKEHGQIEFYRRLSEEMTQRRWENMPVSQSLQTNRGPQPGRIRAVGIVGIERKLEEKRKETDKNISEAFEDLSKLMIKAKEMVELSKSIANKIKDKQGDITEDETIRFKSYLLSMGIANPVTRETYGSGTQYHMQLAKQLAGILQVPLEERGGIMSLTEVYCLVNRARGMELLSPEDLVNACKMLEALKLPLRLRVFDSGVMVIELQSHKEEEMVASALETVSEKGSLTSEEFAKLVGMSVLLAKERLLLAEKMGHLCRDDSVEGLRFYPNLFMTQS"	"unreviewed"	"{'taxId': '9601', 'scientificName': 'Pongo abelii', 'fullName': 'Pongo abelii (Sumatran orangutan)'}"
