"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A2I3LP52"	"{'domain_architectures': 30139, 'entries': 10, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'ssf': 1, 'panther': 1, 'pfam': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 30139}"	"['Acts as a component of the translation initiation factor 2B (eIF2B) complex, which catalyzes the exchange of GDP for GTP on eukaryotic initiation factor 2 (eIF2) gamma subunit. Its guanine nucleotide exchange factor activity is repressed when bound to eIF2 complex phosphorylated on the alpha subunit, thereby limiting the amount of methionyl-initiator methionine tRNA available to the ribosome and consequently global translation is repressed']"	"EIF2B1"	""	"A0A2I3LP52_PAPAN"	"22494587f6b739b485007c3a0a6eb4fbe55754ab"	True	False	False	202	"Translation initiation factor eIF2B subunit alpha"	3	"UP000028761"	"MKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVDSSVAVSSGGELFLRFISLTSLEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLDAAVGLEPTRWLCVPKHRINLSMRLQKVSSLSDSFH"	"unreviewed"	"{'taxId': '9555', 'scientificName': 'Papio anubis', 'fullName': 'Papio anubis (Olive baboon)'}"