"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A2I2YCX4"	"{'domain_architectures': 20645, 'entries': 14, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 2, 'pfam': 1, 'smart': 1, 'profile': 1, 'cdd': 1, 'panther': 1, 'prints': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 20645}"	"['Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds to G(i)-alpha and G(o)-alpha, but not to G(s)-alpha']"	"RGS5"	""	"A0A2I2YCX4_GORGO"	"3962b823cbd84ba1c9ff3d7eb9ca5befd0245855"	True	False	181	"Regulator of G-protein signaling 5"	4	"UP000001519"	"MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKPSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMADKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK"	"unreviewed"	"{'taxId': '9595', 'scientificName': 'Gorilla gorilla gorilla', 'fullName': 'Gorilla gorilla gorilla (Western lowland gorilla)'}"