"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A2D1KSB7"	"{'domain_architectures': 3246, 'entries': 6, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'hamap': 1, 'panther': 1, 'pirsf': 1, 'ncbifam': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 3246}"	"['Involved in the PASTA kinase-mediated signaling pathway regulating peptidoglycan synthesis to maintain cell wall integrity']"	"reoM"	""	"A0A2D1KSB7_9LACO"	"eb99c53e62df3060ebc9f19b7ce1b7fd029bfcc9"	True	False	85	"Peptidoglycan synthesis regulatory protein ReoM"	3	"UP000223559"	"MSSLDKTVSFDFGREQPKNVQQTLETVYQALEEKGYNPINQIVGYLLSGDPAYIPRYNDARNLIRKHERDEIIEELVRNYLKKER"	"unreviewed"	"{'taxId': '1423822', 'scientificName': 'Loigolactobacillus coryniformis subsp. torquens DSM 20004 = KCTC 3535', 'fullName': 'Loigolactobacillus coryniformis subsp. torquens DSM 20004 = KCTC 3535'}"