"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A286XHU3"	"{'domain_architectures': 2987, 'entries': 4, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 1, 'panther': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 2987}"	"['Assembly factor for cytochrome c oxidase (respiratory chain complex IV). Stabilizes an early formation of cytochrome c oxidase assembly factors, until it is displaced by the metallochaperone copper-delivery protein COX17']"	"COA5"	""	"A0A286XHU3_CAVPO"	"48883db4bcf29d4ee6c204ddb7e402633170ecd3"	True	False	74	"Cytochrome c oxidase assembly factor 5"	3	"UP000005447"	"MPRYYEDKPQGGACAGLKEDLGACLLQSDCVLQEGKSPRECLKEGYCKALKYSFFECKRSMLDARSRFRGRKGY"	"unreviewed"	"{'taxId': '10141', 'scientificName': 'Cavia porcellus', 'fullName': 'Cavia porcellus (Guinea pig)'}"