"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A250XV42"	"{'domain_architectures': 3310, 'entries': 5, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'pirsf': 1, 'panther': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 3310}"	"['Component of the BLOC-1 complex, a complex that is required for normal biogenesis of lysosome-related organelles (LRO), such as platelet dense granules and melanosomes. In concert with the AP-3 complex, the BLOC-1 complex is required to target membrane protein cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals. The BLOC-1 complex, in association with SNARE proteins, is also proposed to be involved in neurite extension. Plays a role in intracellular vesicle trafficking and synaptic vesicle recycling']"	"Snapin"	"[{'identifier': 'GO:0006886', 'name': 'intracellular protein transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0031083', 'name': 'BLOC-1 complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0A250XV42_CASCN"	"a9c8028288f3a69e54db0bf4c264e51fcf6e1c63"	True	False	136	"SNARE-associated protein Snapin"	3	"UP001732720"	"MAGSGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHNVAKETARRRAMLDSGIYPPGSPSK"	"unreviewed"	"{'taxId': '51338', 'scientificName': 'Castor canadensis', 'fullName': 'Castor canadensis (American beaver)'}"