"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A1X0XVB7"	"{'domain_architectures': 49157, 'entries': 11, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'hamap': 1, 'ncbifam': 1, 'panther': 1, 'pfam': 1, 'prosite': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 49157}"	"['Binds 16S rRNA, required for the assembly of 30S particles and may also be responsible for determining the conformation of the 16S rRNA at the A site']"	"rpsZ"	"[{'identifier': 'GO:0003735', 'name': 'structural constituent of ribosome', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005840', 'name': 'ribosome', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0A1X0XVB7_LEVBR"	"73a55bc605f5d10b7a90e4800b26c31c42c6bac8"	True	False	False	61	"Small ribosomal subunit protein uS14"	3	""	"MAKKSQIAKNKRPAKFSTQAYTRCERCGRPHSVYQKFHLCRICLRELAHKGQIPGMKKASW"	"unreviewed"	"{'taxId': '1580', 'scientificName': 'Levilactobacillus brevis', 'fullName': 'Levilactobacillus brevis'}"
