"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A1S3ALV1"	"{'domain_architectures': 61465, 'entries': 11, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'profile': 1, 'cdd': 1, 'ssf': 1, 'smart': 1, 'pfam': 1, 'panther': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 61465}"	"[""Plays a role in pre-mRNA splicing as component of the U4/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex). The heptameric LSM2-8 complex binds specifically to the 3'-terminal U-tract of U6 snRNA""]"	"LSM2"	"[{'identifier': 'GO:0003723', 'name': 'RNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006397', 'name': 'mRNA processing', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A0A1S3ALV1_ERIEU"	"83b18cf71a575d59c0de6840812ffe7912383fc4"	True	False	185	"U6 snRNA-associated Sm-like protein LSm2"	3	"UP001652624"	"MGARPSGRKSVGRKPRPSQALGSARRYLPLSPSLEPAEHCASLPYSRLLLRLRGPAPLHARLRAPLRPAFGPAAPGPVFALRPAAPRTSTMLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ"	"unreviewed"	"{'taxId': '9365', 'scientificName': 'Erinaceus europaeus', 'fullName': 'Erinaceus europaeus (Western European hedgehog)'}"