"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A1E9PLI3"	"{'domain_architectures': 19143, 'entries': 16, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'pfam': 3, 'cathgene3d': 2, 'cdd': 1, 'smart': 1, 'pirsf': 1, 'ncbifam': 1, 'panther': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 19143}"	"[""Confers DNA tethering and processivity to DNA polymerases and other proteins. Acts as a clamp, forming a ring around DNA (a reaction catalyzed by the clamp-loading complex) which diffuses in an ATP-independent manner freely and bidirectionally along dsDNA. Initially characterized for its ability to contact the catalytic subunit of DNA polymerase III (Pol III), a complex, multichain enzyme responsible for most of the replicative synthesis in bacteria; Pol III exhibits 3'-5' exonuclease proofreading activity. The beta chain is required for initiation of replication as well as for processivity of DNA replication""]"	"dnaN"	"[{'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003887', 'name': 'DNA-directed DNA polymerase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0008408', 'name': ""3'-5' exonuclease activity"", 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006260', 'name': 'DNA replication', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0009360', 'name': 'DNA polymerase III complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0A1E9PLI3_9LACT"	"bfad543c1c3a99ab704fbd29a259ed902f9a9bab"	True	False	383	"Beta sliding clamp"	3	"UP000250354"	"MKFTIKRSIFVDHLNNVQRAISSRTTIPILTGIKIAVLDSGIILTGSDSTISIEIYISKEDESNQLSIAETGSIVLPSRFLGDIVKKLPEDQLTLEVQDNLQTVIRSGESVFNLNGTAGSEYPTLPEIDADSTYVLPGHLFKRVVNHTIISVSNQQIRPLFTGVHFILADEQLKAVSTDSHRLSQRIVPLTMPEESRGKALEINIPGQTLTELTRLVDDNEDIEMMVTDNQVLFKIDNVYLYSRLLEGNYPDTDRLLSLDYNTKIKVDAQELVHAVERALILSHQGKNNVVKLSLSQEEAILSGHSSEIGYVKERLSLLSFEGDDLEISFNPDYLREALRSFGGQDVVIRFVNPTHSFILTPSEDEDEFNMVQLITPIRTPGN"	"unreviewed"	"{'taxId': '2976810', 'scientificName': 'Aerococcus mictus', 'fullName': 'Aerococcus mictus'}"
