"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A1B1FDV1"	"{'domain_architectures': 10537, 'entries': 13, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'profile': 1, 'smart': 1, 'pfam': 1, 'pirsf': 1, 'panther': 1, 'prints': 2, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 10537}"	"['Promotes the survival of neuronal populations that are all located either in the central nervous system or directly connected to it']"	""	"[{'identifier': 'GO:0005102', 'name': 'signaling receptor binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A0A1B1FDV1_9NEOB"	"14e7fbcc4dc6e965afe2e82a5cba6c0dea182441"	True	False	True	151	"Brain-derived neurotrophic factor"	3	""	"GGLPSLTDTFEQVIEELLEEEQTIRQSEENKDSDMYSSRVMLSTQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMTGQTVTVLEKVPVPKGQLKQYFYETKCNPMGYMKDGCRGIDKRYWN"	"unreviewed"	"{'taxId': '157586', 'scientificName': 'Rana macrocnemis', 'fullName': 'Rana macrocnemis (Iranian long-legged frog)'}"
