"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A177AMD4"	"{'domain_architectures': 0, 'entries': 3, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'pirsf': 1, 'panther': 1, 'interpro': 1}, 'proteome': 0, 'taxonomy': 1}"	"['Component of the mitochondrial ribosome (mitoribosome), a dedicated translation machinery responsible for the synthesis of mitochondrial genome-encoded proteins, including at least some of the essential transmembrane subunits of the mitochondrial respiratory chain. The mitoribosomes are attached to the mitochondrial inner membrane and translation products are cotranslationally integrated into the membrane']"	"VC83_00182"	"[{'identifier': 'GO:0003735', 'name': 'structural constituent of ribosome', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0032543', 'name': 'mitochondrial translation', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A0A177AMD4_9PEZI"	""	True	False	False	98	"Small ribosomal subunit protein mS37"	3	""	"MPPKKVAVPKALTARLPPLPNLRVKRPNQNNNNPCLGLMTSVLTCWASSGYSVAGCSALETSLRACMDKPRPKDVKKNTINYHLSRMYPQIVGPRKRK"	"unreviewed"	"{'taxId': '655981', 'scientificName': 'Pseudogymnoascus destructans', 'fullName': 'Pseudogymnoascus destructans'}"