"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A172C074"	"{'domain_architectures': 5960, 'entries': 7, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'panther': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 5960}"	"['RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate in the photorespiration process. Both reactions occur simultaneously and in competition at the same active site']"	"rbcL"	"[{'identifier': 'GO:0016984', 'name': 'ribulose-bisphosphate carboxylase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0015977', 'name': 'carbon fixation', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A0A172C074_CRAPL"	"4d0b693a5d3946089f4c4facbe3b8395431c8146"	True	False	True	145	"Ribulose bisphosphate carboxylase large chain"	3	""	"KLTYYTPQYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEAVPGETDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPTAYVKTFQGPPHGIQVERDKLNKY"	"unreviewed"	"{'taxId': '4153', 'scientificName': 'Craterostigma plantagineum', 'fullName': 'Craterostigma plantagineum (Blue gem)'}"