"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A162QL07"	"{'domain_architectures': 155, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 2, 'cathgene3d': 1, 'profile': 1, 'ncbifam': 1, 'panther': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 155}"	"[""Regulates mitochondrial small subunit maturation by controlling 15S rRNA 5'-end processing. Localizes to the 5' precursor of the 15S rRNA in a position that is subsequently occupied by mS47 in the mature yeast mtSSU. Uses structure and sequence-specific RNA recognition, binding to a single-stranded region of the precursor and specifically recognizing bases -6 to -1. The exchange of Ccm1 for mS47 is coupled to the irreversible removal of precursor rRNA that is accompanied by conformational changes of the mitoribosomal proteins uS5m and mS26. These conformational changes signal completion of 5'-end rRNA processing through protection of the mature 5'-end of the 15S rRNA and stabilization of mS47. The removal of the 5' precursor together with the dissociation of Ccm1 may be catalyzed by the 5'-3' exoribonuclease Pet127. Involved in the specific removal of group I introns in mitochondrial encoded transcripts""]"	"MUCCIDRAFT_122631"	"[{'identifier': 'GO:0005515', 'name': 'protein binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A0A162QL07_MUCCL"	"c1ed5a32086efd3f33c1a06a97249317ac762f30"	True	False	True	165	"Pentacotripeptide-repeat region of PRORP domain-containing protein"	3	"UP000077051"	"PTLHTYNTLLGCYKRVNNVDRAEEILAEMKQHKIKPDTVTYNTMLHLLLRTHHYQRMMDMYQAMKADKARPDSYTFSTLLDAAVKSKDLHFGSEIYGQITQKCKPKDAYQIFSDMTAAKLKPDVVTYGTLIDAEAKMGHLKASIQLFQDMCNASIEPNDRIFNSL"	"unreviewed"	"{'taxId': '747725', 'scientificName': 'Mucor lusitanicus CBS 277.49', 'fullName': 'Mucor lusitanicus CBS 277.49'}"
