"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A133PZX6"	"{'domain_architectures': 10917, 'entries': 14, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'profile': 2, 'cdd': 1, 'pfam': 1, 'pirsf': 1, 'ncbifam': 1, 'panther': 1, 'hamap': 1, 'prosite': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 10917}"	"[""Catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the biosynthesis of pyridoxal 5'-phosphate. The resulting ammonia molecule is channeled to the active site of PdxS""]"	"pdxT"	"[{'identifier': 'GO:0004359', 'name': 'glutaminase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0042819', 'name': 'vitamin B6 biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0042823', 'name': 'pyridoxal phosphate biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A0A133PZX6_STALU"	"d9ee68446c1df6c0159dbd7c94d6823ab2b3a72d"	True	False	False	184	"Pyridoxal 5'-phosphate synthase subunit PdxT"	3	""	"MKIGVLALQGAVREHIRHIELSGHEGIAIKRVEQLEEIDGLILPGGESTTLRRLMDLYGFKEKLQQSNLPMFGTCAGLIVLAKHVEGETGYLKKLDITVERNSFGRQVDSFESELDIKGIAEDIEGVFIRAPHIASVEDGVEVLSTVGDKIVAVKQGNYLGVSFHPELTDDYRVTQYFIEHMVK"	"unreviewed"	"{'taxId': '28035', 'scientificName': 'Staphylococcus lugdunensis', 'fullName': 'Staphylococcus lugdunensis'}"