"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A0T7CNN9"	"{'domain_architectures': 27502, 'entries': 10, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'smart': 1, 'ncbifam': 1, 'hamap': 1, 'panther': 1, 'pfam': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 27502}"	"[""Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits""]"	"rpoZ"	"[{'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003899', 'name': 'DNA-directed RNA polymerase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006351', 'name': 'DNA-templated transcription', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A0A0T7CNN9_BORP1"	"e86b40bc3674d898b799b1be30e5ef4e4a4b7a40"	True	False	False	67	"DNA-directed RNA polymerase subunit omega"	3	"UP000005250"	"MARITVEDCLNQIPNRFKLTLAATYRARELVQGHAPRLDSKDKPTVTALREIASGLTGLEMLRKVPT"	"unreviewed"	"{'taxId': '568706', 'scientificName': 'Bordetella pertussis (strain ATCC 9797 / DSM 5571 / CCUG 30873 / LMG 14455 / NCTC 10739 / 18323)', 'fullName': 'Bordetella pertussis (strain ATCC 9797 / DSM 5571 / CCUG 30873 / LMG 14455 / NCTC 10739 / 18323)'}"