"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A0P9QWA3"	"{'domain_architectures': 30296, 'entries': 11, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'ncbifam': 3, 'pfam': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 30296}"	"['Catalyzes the aldol cleavage of 4-hydroxy-4-methyl-2-oxoglutarate (HMG) into 2 molecules of pyruvate. Also contains a secondary oxaloacetate (OAA) decarboxylase activity due to the common pyruvate enolate transition state formed following C-C bond cleavage in the retro-aldol and decarboxylation reactions']"	"AC496_2762"	"[{'identifier': 'GO:0008428', 'name': 'ribonuclease inhibitor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0051252', 'name': 'regulation of RNA metabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A0A0P9QWA3_PSESG"	"7ba918e63a501c46e37074330479cf2ec61ab795"	True	False	False	162	"4-hydroxy-4-methyl-2-oxoglutarate aldolase"	3	"UP000037836"	"MHYITPDLCDAYPDLIQVVEPMFSNFGGRDSFGGQIVTVKCFEDNSLVKEQVELDGKGKVLVVDGGGSLRCALLGDMLAEKAARSGWEGMLIYGCIRDVDVIAQTDLGVQALASHPKKTEKRGIGDLNVLVTFGGVTFRPGEYLYADNNGVIISPSPLTMPE"	"unreviewed"	"{'taxId': '318', 'scientificName': 'Pseudomonas savastanoi pv. glycinea', 'fullName': 'Pseudomonas savastanoi pv. glycinea'}"