"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A0D9RBY1"	"{'domain_architectures': 17178, 'entries': 5, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'cathgene3d': 1, 'ssf': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 17178}"	"['Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space']"	"TIMM8A"	""	"A0A0D9RBY1_CHLSB"	"f9178374a5901be0d54a7f9dfe55ffbddb0efa3a"	True	False	False	97	"Mitochondrial import inner membrane translocase subunit"	3	"UP000029965"	"MDSSSSSSAAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSKPVFSESLSD"	"unreviewed"	"{'taxId': '60711', 'scientificName': 'Chlorocebus sabaeus', 'fullName': 'Chlorocebus sabaeus (Green monkey)'}"