"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A0C2XVQ9"	"{'domain_architectures': 182942, 'entries': 12, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'profile': 1, 'cathgene3d': 1, 'cdd': 1, 'pfam': 1, 'panther': 1, 'prosite': 1, 'prints': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 182942}"	"['Oxidized purine nucleoside triphosphate hydrolase which is a prominent sanitizer of the oxidized nucleotide pool. Catalyzes the hydrolysis of 2-oxo-dATP (2-hydroxy-dATP) into 2-oxo-dAMP. Also has a significant hydrolase activity toward 2-oxo-ATP, 8-oxo-dGTP and 8-oxo-dATP. Through the hydrolysis of oxidized purine nucleoside triphosphates, prevents their incorporation into DNA and the subsequent transversions A:T to C:G and G:C to T:A. Also catalyzes the hydrolysis of methylated purine nucleoside triphosphate preventing their integration into DNA. Through this antimutagenic activity protects cells from oxidative stress']"	"M408DRAFT_326650"	"[{'identifier': 'GO:0016787', 'name': 'hydrolase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0008413', 'name': '8-oxo-7,8-dihydroguanosine triphosphate pyrophosphatase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0042262', 'name': 'DNA protection', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A0A0C2XVQ9_SERVB"	"752b3b6d9807717ea1f029db1420a2538cb188ca"	True	False	228	"Oxidized purine nucleoside triphosphate hydrolase"	3	"UP000054097"	"MEAQLQVPAGLEGCNPHGAKLQIYQEGGRSEWMQYSAVKMFTNAFVINTAKQQMLLGYKKRGFATGVYNGFGGKVDIGETSLEAAHRELKEEAGIEASLEHCGVLFFYQEGHQYAHFIDIYRADSWTGEPTETDEMKPQWFQIPSLSGSLVNLAEDLAKTEQGGSETSHTTIPLHRMWKDDVLWYPLLLSKRRFIGRVDLVEAPSTPEPLDPSAPLHPLVKWWFATID"	"unreviewed"	"{'taxId': '933852', 'scientificName': 'Serendipita vermifera MAFF 305830', 'fullName': 'Serendipita vermifera MAFF 305830'}"