"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A093EN12"	"{'domain_architectures': 107668, 'entries': 12, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 1, 'cdd': 1, 'smart': 1, 'cathgene3d': 1, 'pfam': 1, 'ssf': 1, 'panther': 1, 'prosite': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 107668}"	"[""Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-, as well as 'Lys-63'-linked polyubiquitination. May be involved in degradation of muscle-specific proteins. Mediates polyubiquitination of CYP3A4""]"	"N339_07601"	""	"A0A093EN12_9AVES"	"96b2a7d582dea26386e8f982d2fd40014d2b06f9"	True	True	129	"Ubiquitin-conjugating enzyme E2 G1"	3	"UP000053149"	"YTELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAA"	"unreviewed"	"{'taxId': '240206', 'scientificName': 'Pterocles gutturalis', 'fullName': 'Pterocles gutturalis (yellow-throated sandgrouse)'}"