"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A091HML3"	"{'domain_architectures': 30139, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'pfam': 1, 'panther': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 30139}"	"['Acts as a component of the translation initiation factor 2B (eIF2B) complex, which catalyzes the exchange of GDP for GTP on eukaryotic initiation factor 2 (eIF2) gamma subunit. Its guanine nucleotide exchange factor activity is repressed when bound to eIF2 complex phosphorylated on the alpha subunit, thereby limiting the amount of methionyl-initiator methionine tRNA available to the ribosome and consequently global translation is repressed']"	"N300_05652"	""	"A0A091HML3_CALAN"	"22494587f6b739b485007c3a0a6eb4fbe55754ab"	True	False	True	298	"Translation initiation factor eIF2B subunit beta"	3	"UP000054308"	"SGELMDLIRREGQRMTAAQPSETTVGNMVRRVLKVIREEYGRLHGRSEESDQQESLHKLLTSGGLSEDFSTPYPPLRANVIEAINELLIELEGTTDNIAMQALEHIHSNEVIMTIGYSRTVEAFLKEAARKRKFQVIVAECAPFCQGHEMAVRLSKENIETTVMSDAAIFAVMSRVNKVIIGTKTILANGALIAVSGTHTLALAAKHHSTPLIVCAPMFKLSPQFLNEEDSFHKFVSPQEVLPFTEGEILAKINIHCPVFDYVPPELITLFISNIGGNAPSYIYRLMSELYHPDDYEL"	"unreviewed"	"{'taxId': '9244', 'scientificName': 'Calypte anna', 'fullName': ""Calypte anna (Anna's hummingbird)""}"