"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A087GS99"	"{'domain_architectures': 71987, 'entries': 11, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'profile': 1, 'ssf': 1, 'smart': 1, 'pfam': 1, 'cdd': 1, 'panther': 1, 'prints': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 71987}"	"['Probably acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways']"	"AALP_Aa6g284000"	"[{'identifier': 'GO:0003700', 'name': 'DNA-binding transcription factor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006355', 'name': 'regulation of DNA-templated transcription', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A0A087GS99_ARAAL"	"f99f3afd61c8c30218b9877f305a9cb4dc00789b"	True	False	False	161	"AP2/ERF domain-containing protein"	3	"UP000029120"	"METGAATAATAAAMGIGTRKRDQKPYKGIRMRKWGKWVAEIREPNKRSRIWLGSYSTPEAAARAYDTAVFYLRGPSARLNFPELLAGLTVSCGGGGDMSAAYIRRKAAEVGAQVDAAVVVKSDGGDNGIRSCNGSLERVDLNKLPDPEDDDENVCLYDVCL"	"unreviewed"	"{'taxId': '50452', 'scientificName': 'Arabis alpina', 'fullName': 'Arabis alpina (Alpine rock-cress)'}"
