"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A075WIN1"	"{'domain_architectures': 7534, 'entries': 10, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'profile': 1, 'pfam': 1, 'panther': 1, 'ncbifam': 1, 'prosite': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 7534}"	""	"AFULGI_00023220"	"[{'identifier': 'GO:0016625', 'name': 'oxidoreductase activity, acting on the aldehyde or oxo group of donors, iron-sulfur protein as acceptor', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0051539', 'name': '4 iron, 4 sulfur cluster binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A0A075WIN1_ARCFL"	"0cd458f8c5e6d11a778a12b276129ddb8e452f81"	True	False	False	82	"4Fe-4S ferredoxin-type domain-containing protein"	4	""	"MRLDSLISKSTAGSAGETGSWRILRPVVDEKKCSGCKECFYYCPEGVIQVDVFARIDYRFCKGCGVCGEVCRQKAIVMVPEE"	"unreviewed"	"{'taxId': '1344584', 'scientificName': 'Archaeoglobus fulgidus DSM 8774', 'fullName': 'Archaeoglobus fulgidus DSM 8774'}"