EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF08105 - Antimicrobial10)
FAM  PF08105
PID  Antimicrobial10
DES  Metchnikowin family
ANO  2
ALN  52
AID  1
APH  (MTK_DROME/1-52:0.00000,Q6XMH9_DROSI/1-52:0.00000);
ATP  (MTK_DROME/1-52,Q6XMH9_DROSI/1-52);
ATL  0
DNO  2
DLN  156
DID  0.99359
DPH  (MTK_DROME/1-52:0.00077,Q6XMH9_DROSI/1-52:0.00569);
DTP  (MTK_DROME/1-52,Q6XMH9_DROSI/1-52);
DTL  0.00645
RID  1
RPH  (MTK_DROME/1-52:0.00000,Q6XMH9_DROSI/1-52:0.00000);
RTP  (MTK_DROME/1-52,Q6XMH9_DROSI/1-52);
RTL  0
LNK  MTK_DROME/1-52:Q24395:X91060
LNK  Q6XMH9_DROSI/1-52:Q6XMH9:AY224604
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  MTK_DROME/1-52
ASQ  MQLNLGAIFLALLGVMATATSVLAEPHRHQGPIFDTRPSPFNPNQPRPGPIY
DSQ  ATGCAACTTAATCTTGGAGCGATTTTTCTGGCCCTGCTGGGTGTGATGGCCACGGCTACATCAGTGCTGGCAGAGCCTCATCGTCACCAGGGACCCATTTTCGATACGAGGCCGTCGCCCTTCAATCCTAACCAACCAAGACCGGGTCCAATTTAT
TRN  10010101100011001
NAM  Q6XMH9_DROSI/1-52
ASQ  MQLNLGAIFLALLGVMATATSVLAEPHRHQGPIFDTRPSPFNPNQPRPGPIY
DSQ  ATGCAACTTAATCTTGGAGCGATTTTTCTGGCCTTGCTGGGTGTGATGGCCACGGCTACATCAGTGCTGGCAGAGCCTCATCGTCACCAGGGACCCATTTTCGATACGAGGCCGTCGCCCTTCAATCCTAACCAACCAAGACCGGGTCCAATTTAT
TRN  10010101100011001
//