EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF08071 - RS4NT)
FAM  PF08071
PID  RS4NT
DES  RS4NT (NUC023) domain
ANO  17
ALN  39
AID  0.505537
APH  ((Q6PBC4_XENTR/3-40:0.08609,(((RS4E_METVA/4-41:0.05452,RS4E_METJA/4-41:0.39869):0.09009,(RS4E_METKA/6-44:0.24030,((RS4E_AERPE/4-41:0.33124,RS4E_METTH/4-41:0.49674):0.17992,RS4E_PYRHO/4-41:0.18710):0.11728):0.19270):0.50319,(RS4_YARLI/3-40:0.04621,(O14378_SCHPO/3-40:0.13942,Q7M4V2_EMENI/3-40:0.22142):0.05666):0.03877):0.05640):0.06388,(((RS4_CHLS6/3-40:1.00864,Q8IIU8_PLAF7/24-61:0.09452):0.20038,(Q9XG32_GUITH/3-40:0.26207,Q7R3M9_GIALA/3-40:0.17080):0.06715):0.06767,(Q8SRB9_ENCCU/3-40:0.51636,Q6QU83_MAIZE/3-40:0.06270):0.03207):0.06235,Q7PT95_ANOGA/2-39:0.08722);
ATP  ((Q6PBC4_XENTR/3-40,(((RS4E_METVA/4-41,RS4E_METJA/4-41),(RS4E_METKA/6-44,((RS4E_AERPE/4-41,RS4E_METTH/4-41),RS4E_PYRHO/4-41))),(RS4_YARLI/3-40,(O14378_SCHPO/3-40,Q7M4V2_EMENI/3-40)))),(((RS4_CHLS6/3-40,Q8IIU8_PLAF7/24-61),(Q9XG32_GUITH/3-40,Q7R3M9_GIALA/3-40)),(Q8SRB9_ENCCU/3-40,Q6QU83_MAIZE/3-40)),Q7PT95_ANOGA/2-39);
ATL  6.13255
DNO  14
DLN  117
DID  0.535377
DPH  (((((((O14378_SCHPO/3-40:0.22816,RS4_YARLI/3-40:0.12993):0.06655,(Q7PT95_ANOGA/2-39:0.23598,Q6PBC4_XENTR/3-40:0.12292):0.04579):0.04288,((Q6QU83_MAIZE/3-40:0.14339,(Q8SRB9_ENCCU/3-40:0.40132,(Q9XG32_GUITH/3-40:0.31903,Q7R3M9_GIALA/3-40:0.24880):0.17354):0.07866):0.06124,Q8IIU8_PLAF7/24-61:0.38417):0.08470):0.34716,RS4E_METKA/6-44:0.19584):0.21490,RS4E_PYRHO/4-41:0.19496):0.26425,RS4E_METJA/4-41:0.17953):0.09551,RS4E_METTH/4-41:0.38763,RS4E_METVA/4-41:0.15778);
DTP  (((((((O14378_SCHPO/3-40,RS4_YARLI/3-40),(Q7PT95_ANOGA/2-39,Q6PBC4_XENTR/3-40)),((Q6QU83_MAIZE/3-40,(Q8SRB9_ENCCU/3-40,(Q9XG32_GUITH/3-40,Q7R3M9_GIALA/3-40))),Q8IIU8_PLAF7/24-61)),RS4E_METKA/6-44),RS4E_PYRHO/4-41),RS4E_METJA/4-41),RS4E_METTH/4-41,RS4E_METVA/4-41);
DTL  4.76694
RID  0.546914
RPH  (((((((((((Q9XG32_GUITH/3-40:0.25737,Q7R3M9_GIALA/3-40:0.16904):0.08523,Q8IIU8_PLAF7/24-61:0.28664):0.04816,(Q8SRB9_ENCCU/3-40:0.51009,Q6QU83_MAIZE/3-40:0.06149):0.03320):0.06293,Q7PT95_ANOGA/2-39:0.08679):0.06619,Q6PBC4_XENTR/3-40:0.08293):0.08524,RS4_YARLI/3-40:0.04541):0.01267,O14378_SCHPO/3-40:0.19135):0.58620,RS4E_PYRHO/4-41:0.09388):0.20463,RS4E_METKA/6-44:0.27407):0.11043,RS4E_METTH/4-41:0.58513):0.08008,RS4E_METVA/4-41:0.13745,RS4E_METJA/4-41:0.32077);
RTP  (((((((((((Q9XG32_GUITH/3-40,Q7R3M9_GIALA/3-40),Q8IIU8_PLAF7/24-61),(Q8SRB9_ENCCU/3-40,Q6QU83_MAIZE/3-40)),Q7PT95_ANOGA/2-39),Q6PBC4_XENTR/3-40),RS4_YARLI/3-40),O14378_SCHPO/3-40),RS4E_PYRHO/4-41),RS4E_METKA/6-44),RS4E_METTH/4-41),RS4E_METVA/4-41,RS4E_METJA/4-41);
RTL  4.50585
LNK  O14378_SCHPO/3-40:O14378:U97374
LNK  Q6PBC4_XENTR/3-40:Q6PBC4:BC059771
LNK  Q6QU83_MAIZE/3-40:Q6QU83:AY525608
LNK  Q7M4V2_EMENI/3-40:Q7M4V2:
LNK  Q7PT95_ANOGA/2-39:Q7PT95:AAAB01008807
LNK  Q7R3M9_GIALA/3-40:Q7R3M9:AACB01000014
LNK  Q8IIU8_PLAF7/24-61:Q8IIU8:AE014836
LNK  Q8SRB9_ENCCU/3-40:Q8SRB9:AL590448
LNK  Q9XG32_GUITH/3-40:Q9XG32:AJ010592
LNK  RS4_CHLS6/3-40:Q40941:
LNK  RS4E_AERPE/4-41:Q9YF85:
LNK  RS4E_METJA/4-41:P54039:U67497
LNK  RS4E_METKA/6-44:Q8TW18:AE010413
LNK  RS4E_METTH/4-41:O26123:AE000795
LNK  RS4E_METVA/4-41:P14023:X16720
LNK  RS4E_PYRHO/4-41:O59430:AP000007
LNK  RS4_YARLI/3-40:O59950:AF054511
AMK  xxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q7M4V2_EMENI/3-40
ASQ  RGPKKHQKRLSAASHWLLDKMS.GTYAPKASPGAHKLRD
NAM  O14378_SCHPO/3-40
ASQ  RGPKKHFKRVAAPHHWLLDKLS.GTYAPKPSPGPHKARE
DSQ  CGAGGTCCTAAAAAGCATTTCAAGCGTGTTGCTGCCCCTCACCACTGGCTTTTGGACAAGCTCTCC...GGAACTTACGCTCCAAAGCCTTCTCCAGGTCCTCATAAGGCCCGTGAG
TRN  11011101111011011
NAM  Q6PBC4_XENTR/3-40
ASQ  RGPKKHLKRVAAPKHWMLDKLT.GVFAPRPSTGPHKLRE
DSQ  CGCGGACCGAAGAAGCATTTGAAGCGCGTTGCTGCGCCCAAACATTGGATGTTGGACAAGCTGACT...GGTGTCTTTGCTCCTCGTCCATCCACTGGTCCCCACAAGCTCCGTGAG
TRN  11011101101011011
NAM  Q7PT95_ANOGA/2-39
ASQ  RGPKKHLKRLNAPRGWMLDKTG.GTFAPRPSTGPHKLRE
DSQ  CGCGGTCCGAAGAAACATTTGAAGCGTTTAAATGCTCCACGAGGATGGATGTTGGACAAGACCGGC...GGTACCTTCGCGCCGCGTCCGTCCACCGGCCCACACAAGCTGCGCGAA
TRN  11011101101011010
NAM  RS4_YARLI/3-40
ASQ  RGPKKHLKRLAAPSHWMLDKLS.GTYAPRSSAGPHKLRE
DSQ  CGAGGACCCAAGAAGCATCTCAAGCGACTCGCAGCTCCCTCCCACTGGATGCTGGACAAGCTGTCC...GGCACCTACGCTCCCCGATCGTCTGCCGGTCCCCACAAGCTGCGAGAG
TRN  11011111101111111
NAM  Q6QU83_MAIZE/3-40
ASQ  RGLKKHLKRLNAPKHWMLDKLG.GAFAPKPSSGPHKSRE
DSQ  AGAGGATTGAAGAAGCATTTGAAGAGGCTCAATGCGCCCAAGCATTGGATGCTGGACAAGCTTGGC...GGAGCTTTTGCTCCCAAGCCATCTTCTGGACCTCACAAGTCTAGGGAG
TRN  10010101100011011
NAM  Q7R3M9_GIALA/3-40
ASQ  RGVRKHLKRLNAPKHWLLDKMG.GIWAPRPTNGPHGLRE
DSQ  CGTGGAGTCCGCAAGCACCTTAAGCGCCTCAACGCACCGAAGCACTGGCTTCTAGACAAGATGGGA...GGCATCTGGGCCCCCAGACCTACAAACGGCCCCCATGGCCTCCGCGAG
TRN  10010101110011011
NAM  Q8IIU8_PLAF7/24-61
ASQ  KGIKKHLKRVNAPSHWMLNKMG.GQYAPKTSSGPHKLLE
DSQ  AAAGGTATTAAAAAACACTTAAAAAGGGTGAATGCCCCCTCCCACTGGATGTTGAATAAAATGGGT...GGTCAATATGCCCCCAAGACGAGCAGTGGACCACATAAATTACTTGAG
TRN  10010101110011010
NAM  Q9XG32_GUITH/3-40
ASQ  RGIKKHYKRLNAPKKWLLNKLG.GIWAPRSSSGPHKKQN
DSQ  AGAGGAATCAAAAAACATTATAAAAGATTAAACGCTCCAAAAAAGTGGCTTTTAAATAAGTTGGGG...GGAATATGGGCCCCAAGATCTTCAAGTGGACCTCACAAAAAACAAAAC
TRN  10010101110011000
NAM  Q8SRB9_ENCCU/3-40
ASQ  TGHRDHLKRKTAPKSWMLDKQG.GTFALMPASGPHKKTE
DSQ  ACCGGACATCGCGACCACCTAAAGCGAAAGACGGCGCCGAAGTCGTGGATGCTGGACAAGCAGGGA...GGGACGTTTGCACTAATGCCTGCCAGTGGGCCCCACAAGAAGACGGAG
TRN  11011111101111111
NAM  RS4E_METJA/4-41
ASQ  KGPKRHLKRLAAPVRWELPRKI.HKFTVRPLPGAHPMSE
DSQ  AAAGGTCCAAAAAGACATTTAAAAAGATTGGCAGCTCCAGTTAGATGGGAGTTACCAAGAAAGATT...CACAAATTCACAGTTAGACCATTACCAGGAGCACACCCAATGAGTGAG
TRN  10110101110011010
NAM  RS4E_METVA/4-41
ASQ  KGPRKHLKRLAAPANWQLPRKE.RTFTVRPSPGPHSMDK
DSQ  AAAGGACCTAGAAAACATCTTAAAAGATTGGCTGCTCCAGCAAATTGGCAACTTCCTAGAAAAGAA...AGAACATTTACTGTGAGACCATCACCTGGACCACATTCAATGGACAAA
TRN  10010101110011001
NAM  RS4E_PYRHO/4-41
ASQ  KGPKRHLKRLAAPSSWYIERKA.YKWAVRPRPGPHNMRT
DSQ  AAAGGTCCCAAGAGGCATCTTAAGAGGCTTGCCGCTCCTTCATCTTGGTATATTGAGAGGAAAGCT...TACAAGTGGGCCGTAAGGCCGAGACCAGGACCACACAACATGAGAACG
TRN  10010101110011001
NAM  RS4E_METKA/6-44
ASQ  SGPKRHVKRLAAPYAWPIPRKEgGKFAPRPYPGPHTMDT
DSQ  AGTGGTCCGAAGCGTCACGTGAAGCGTCTCGCGGCCCCGTACGCCTGGCCGATCCCGAGGAAGGAAggtGGTAAGTTCGCACCGAGGCCGTACCCCGGACCGCACACCATGGACACG
TRN  10010101110011011
NAM  RS4E_METTH/4-41
ASQ  MASRKHLKRFKSPVHWPIHPKE.YKWTVKPSPGPHAIEN
DSQ  ATGGCATCAAGAAAACATCTTAAACGATTCAAATCACCGGTTCACTGGCCAATTCATCCCAAGGAA...TACAAATGGACAGTTAAACCATCTCCAGGTCCCCACGCTATTGAGAAC
TRN  10010101110011001
NAM  RS4E_AERPE/4-41
ASQ  MGGQRRLKALAAPRFWPILRKE.YKWAVKPRPGPHPAEK
NAM  RS4_CHLS6/3-40
ASQ  KGIKKHQKRISSNTMIKYKKKL.GIFNTKISSGPHSKVK
//