EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF08052 - PyrBI_leader)
FAM  PF08052
PID  PyrBI_leader
DES  PyrBI operon leader peptide
ANO  2
ALN  44
AID  0.976744
APH  (Q83P61_SHIFL/1-44:0.01480,LPPY_ECOLI/1-44:0.00827);
ATP  (Q83P61_SHIFL/1-44,LPPY_ECOLI/1-44);
ATL  0.02306
DNO  2
DLN  132
DID  0.984849
DPH  (Q83P61_SHIFL/1-44:0.01539,LPPY_ECOLI/1-44:0.00000);
DTP  (Q83P61_SHIFL/1-44,LPPY_ECOLI/1-44);
DTL  0.0154
RID  0.976744
RPH  (Q83P61_SHIFL/1-44:0.00614,LPPY_ECOLI/1-44:0.01692);
RTP  (Q83P61_SHIFL/1-44,LPPY_ECOLI/1-44);
RTL  0.02306
LNK  LPPY_ECOLI/1-44:P09150:M10743
LNK  Q83P61_SHIFL/1-44:Q83P61:AE005674
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q83P61_SHIFL/1-44
ASQ  MVQCVRHFVLPRLKKDAGLPFFFPLITHSQPLNRGAFFCLGVRR
DSQ  ATGGTTCAGTGTGTTCGACATTTTGTCTTACCGCGTCTGAAAAAAGACGCTGGCCTGCCGTTTTTCTTCCCGTTGATCACCCATTCCCAGCCCCTCAATCGAGGGGCTTTTTTTTGCCTAGGTGTCAGGAGA
TRN  10010101100011010
NAM  LPPY_ECOLI/1-44
ASQ  MVQCVRHFVLPRLKKDAGLPFFFPLITHSQPLNRGAFFCPGVRR
DSQ  ATGGTTCAGTGTGTTCGACATTTTGTCTTACCGCGTCTGAAAAAAGACGCTGGCCTGCCGTTTTTCTTCCCGTTGATCACCCATTCCCAGCCCCTCAATCGAGGGGCTTTTTTTTGCCCAGGCGTCAGGAGA
TRN  10010101100011010
//