EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF08020 - DUF1706)
FAM  PF08020
PID  DUF1706
DES  Protein of unknown function (DUF1706)
ANO  14
ALN  177
AID  0.379328
APH  ((Q9L910_ECOLI/1-166:0.34058,(Q6D578_ERWCT/1-167:0.30714,Q8FGD0_ECOL6/1-167:0.23628):0.21007):0.15816,((Q839W6_ENTFA/1-167:0.22758,(Q03036_YEAST/1-167:0.32174,(Q9CN16_PASMU/1-170:0.28873,((Q8DWV2_STRA5/1-170:0.22491,Q8DQ54_STRR6/10-179:0.13947):0.08486,Q8RFR2_FUSNN/11-180:0.22852):0.03878):0.22738):0.09761):0.66438,(Q73PY6_TREDE/1-166:0.44241,Q71WY9_LISMF/1-166:0.50698):0.96356):0.16596,(Q6LQQ6_PHOPR/1-167:0.26876,(Q87NK8_VIBPA/1-167:0.17044,Q8EG45_SHEON/1-167:0.24064):0.06192):0.27740);
ATP  ((Q9L910_ECOLI/1-166,(Q6D578_ERWCT/1-167,Q8FGD0_ECOL6/1-167)),((Q839W6_ENTFA/1-167,(Q03036_YEAST/1-167,(Q9CN16_PASMU/1-170,((Q8DWV2_STRA5/1-170,Q8DQ54_STRR6/10-179),Q8RFR2_FUSNN/11-180)))),(Q73PY6_TREDE/1-166,Q71WY9_LISMF/1-166)),(Q6LQQ6_PHOPR/1-167,(Q87NK8_VIBPA/1-167,Q8EG45_SHEON/1-167)));
ATL  6.89426
DNO  14
DLN  531
DID  0.480433
DPH  (((((((Q8DWV2_STRA5/1-170:0.21999,Q8DQ54_STRR6/10-179:0.14924):0.08960,Q8RFR2_FUSNN/11-180:0.18200):0.06122,Q9CN16_PASMU/1-170:0.23159):0.12030,Q03036_YEAST/1-167:0.29984):0.08034,Q839W6_ENTFA/1-167:0.27769):0.28428,((Q9L910_ECOLI/1-166:0.32617,(Q6D578_ERWCT/1-167:0.25383,Q8FGD0_ECOL6/1-167:0.26436):0.14454):0.05112,(Q6LQQ6_PHOPR/1-167:0.28028,(Q87NK8_VIBPA/1-167:0.20630,Q8EG45_SHEON/1-167:0.24034):0.07645):0.21012):0.18058):0.36751,Q73PY6_TREDE/1-166:0.38093,Q71WY9_LISMF/1-166:0.38350);
DTP  (((((((Q8DWV2_STRA5/1-170,Q8DQ54_STRR6/10-179),Q8RFR2_FUSNN/11-180),Q9CN16_PASMU/1-170),Q03036_YEAST/1-167),Q839W6_ENTFA/1-167),((Q9L910_ECOLI/1-166,(Q6D578_ERWCT/1-167,Q8FGD0_ECOL6/1-167)),(Q6LQQ6_PHOPR/1-167,(Q87NK8_VIBPA/1-167,Q8EG45_SHEON/1-167)))),Q73PY6_TREDE/1-166,Q71WY9_LISMF/1-166);
DTL  5.36212
RID  0.379328
RPH  ((Q9L910_ECOLI/1-166:0.34058,(Q6D578_ERWCT/1-167:0.30714,Q8FGD0_ECOL6/1-167:0.23628):0.21007):0.15816,((Q839W6_ENTFA/1-167:0.22758,(Q03036_YEAST/1-167:0.32174,(Q9CN16_PASMU/1-170:0.28873,((Q8DWV2_STRA5/1-170:0.22491,Q8DQ54_STRR6/10-179:0.13947):0.08486,Q8RFR2_FUSNN/11-180:0.22852):0.03878):0.22738):0.09761):0.66438,(Q73PY6_TREDE/1-166:0.44241,Q71WY9_LISMF/1-166:0.50698):0.96356):0.16596,(Q6LQQ6_PHOPR/1-167:0.26876,(Q87NK8_VIBPA/1-167:0.17044,Q8EG45_SHEON/1-167:0.24064):0.06192):0.27740);
RTP  ((Q9L910_ECOLI/1-166,(Q6D578_ERWCT/1-167,Q8FGD0_ECOL6/1-167)),((Q839W6_ENTFA/1-167,(Q03036_YEAST/1-167,(Q9CN16_PASMU/1-170,((Q8DWV2_STRA5/1-170,Q8DQ54_STRR6/10-179),Q8RFR2_FUSNN/11-180)))),(Q73PY6_TREDE/1-166,Q71WY9_LISMF/1-166)),(Q6LQQ6_PHOPR/1-167,(Q87NK8_VIBPA/1-167,Q8EG45_SHEON/1-167)));
RTL  6.89426
LNK  Q03036_YEAST/1-167:Q03036:U43834
LNK  Q6D578_ERWCT/1-167:Q6D578:BX950851
LNK  Q6LQQ6_PHOPR/1-167:Q6LQQ6:CR378669
LNK  Q71WY9_LISMF/1-166:Q71WY9:AE017330
LNK  Q73PY6_TREDE/1-166:Q73PY6:AE017248
LNK  Q839W6_ENTFA/1-167:Q839W6:AE016947
LNK  Q87NK8_VIBPA/1-167:Q87NK8:BA000031
LNK  Q8DQ54_STRR6/10-179:Q8DQ54:AE008459
LNK  Q8DWV2_STRA5/1-170:Q8DWV2:AE014287
LNK  Q8EG45_SHEON/1-167:Q8EG45:AE015620
LNK  Q8FGD0_ECOL6/1-167:Q8FGD0:AE016762
LNK  Q8RFR2_FUSNN/11-180:Q8RFR2:AE010574
LNK  Q9CN16_PASMU/1-170:Q9CN16:AE006099
LNK  Q9L910_ECOLI/1-166:Q9L910:AF188737
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q8FGD0_ECOL6/1-167
ASQ  MA-VPSSKEELIKAINSNFSLLNKKLESITPQLAFEPLLEGHAKGTTISVANLVSYLIGWGELVLHWHDQEAKGKTIIFPEEGFKWNELGRLAQKFYRDYEDITEYEVLLARLKENKQQLVALIERFSNDELYG---KPWY------NKWTRGRMIQFNTASPYKNASGRLNKLQKC
DSQ  ATGGCT---GTTCCATCATCAAAAGAAGAGTTAATTAAAGCTATTAATAGTAATTTTTCTTTATTAAATAAGAAGCTAGAATCTATTACGCCCCAACTCGCCTTTGAACCTCTATTGGAAGGGCACGCGAAGGGGACTACGATTAGCGTAGCGAATCTGGTTTCCTATCTGATTGGCTGGGGAGAGCTGGTGTTACACTGGCATGACCAAGAGGCAAAAGGAAAAACTATTATTTTTCCTGAGGAAGGATTTAAATGGAATGAATTGGGGCGTTTAGCACAGAAATTCTACCGTGACTATGAGGATATTACAGAGTACGAAGTTTTATTGGCACGGTTAAAGGAAAATAAGCAGCAACTCGTGGCTTTGATTGAACGATTCAGTAACGATGAGCTTTACGGT---------AAACCTTGGTAT------------------AATAAATGGACCCGAGGTCGTATGATTCAATTTAATACCGCCTCGCCTTATAAAAATGCTTCGGGGAGGTTAAATAAACTGCAGAAATGT
TRN  10010101100011000
NAM  Q6D578_ERWCT/1-167
ASQ  MA-VPESKEALIKAINSQFTLLMKKIDAVPAERAFSPEMAGHAQGTQMSPANLVAYLLGWGNVVLKWHEDEEQGKTIDFPEAGYKWNQLGLLAQKFYQDYAPITDWAELIALLAANKLALIALVERYTDEQLYG---EGWY------GKWTRGRMIQFNTAAPYKNAAGRLRTWEKN
DSQ  ATGGCG---GTGCCGGAGAGCAAGGAGGCCTTGATTAAGGCGATCAACAGTCAGTTCACGCTATTAATGAAGAAAATTGACGCAGTGCCTGCAGAGCGAGCGTTCTCGCCAGAAATGGCAGGACATGCGCAGGGGACGCAGATGAGCCCGGCAAATCTGGTGGCGTATTTGCTGGGCTGGGGCAATGTGGTGTTGAAATGGCATGAGGACGAAGAGCAGGGTAAAACCATTGATTTCCCTGAGGCCGGTTATAAATGGAATCAGCTTGGCCTGCTGGCACAAAAATTCTATCAGGATTATGCCCCTATTACCGATTGGGCGGAACTGATCGCGCTGCTTGCCGCGAATAAATTAGCACTCATCGCATTGGTTGAACGCTATACCGATGAACAGCTCTATGGC---------GAAGGCTGGTAC------------------GGCAAGTGGACGCGTGGTCGAATGATTCAGTTCAATACCGCCGCGCCTTATAAAAATGCGGCCGGACGCCTGCGTACGTGGGAGAAAAAC
TRN  11011101101011010
NAM  Q9L910_ECOLI/1-166
ASQ  MS-VPQTKAELLLAIDKNFSKLISYLNTIPPEITSDKSMDGHAKGTEMSVRDLVSYLLGWNALVVKWIASDAKGLPVDFPETGYKWNQLGLLAQKFYSDYSEL-SYELLVAELQTVKNEIVNLINDRTDDILYG---RPWY------TKWTMGRMISFNTSSPYANANGRLRKWAKN
DSQ  ATGAGT---GTGCCGCAAACAAAAGCTGAACTGCTTTTAGCTATTGATAAAAATTTTAGTAAATTAATTAGTTACCTCAACACAATCCCACCAGAAATTACTTCAGATAAATCAATGGACGGACACGCCAAAGGAACGGAGATGAGTGTTCGTGATCTCGTTTCGTATCTGCTTGGATGGAATGCTCTTGTTGTAAAGTGGATCGCTTCTGATGCTAAAGGTCTGCCTGTCGATTTTCCGGAAACTGGCTATAAATGGAATCAGCTTGGCCTTCTTGCTCAAAAATTTTACTCAGATTACAGTGAGTTA---AGTTATGAGTTGTTAGTAGCTGAACTTCAGACTGTAAAAAATGAGATTGTGAACCTTATTAATGATCGTACCGATGATATTTTGTATGGA---------AGACCATGGTAC------------------ACAAAATGGACGATGGGGAGAATGATCTCATTTAACACATCTTCGCCTTACGCCAACGCTAATGGAAGATTAAGAAAGTGGGCAAAAAAT
TRN  10010101100011000
NAM  Q8EG45_SHEON/1-167
ASQ  MSSVPQSKQELELAIHSVFPKLMADYRSIPAQMSRVCSIDGNIQGTQISVCDTVAYLIGWGKLVLKWYELTSQTLPVDFPDTGYKWNQLELLADRFHQEYHQW-QYSDLLNEYELTMAKLLTLIASLSVQQLYG---IAWY------DKWTLGRMIQFNTYSPMKNMRTKVRRFKKD
DSQ  ATGTCATCTGTACCCCAATCAAAACAAGAGCTTGAATTGGCTATTCACTCAGTCTTTCCCAAATTGATGGCAGACTATCGTTCAATCCCAGCCCAAATGTCCCGCGTGTGCAGCATTGACGGAAACATCCAAGGTACACAAATTAGCGTCTGCGATACTGTTGCGTACCTTATTGGCTGGGGTAAATTAGTACTCAAATGGTACGAACTCACATCGCAAACCCTACCCGTTGATTTTCCTGATACGGGATATAAATGGAATCAACTGGAATTGCTAGCAGATCGGTTTCACCAAGAATATCACCAATGG---CAATATTCTGATTTACTTAATGAATATGAACTGACCATGGCCAAACTGCTAACGCTGATTGCGAGCCTCAGTGTTCAGCAACTGTACGGC---------ATCGCTTGGTAC------------------GATAAATGGACATTGGGCCGTATGATCCAGTTCAACACTTACTCCCCAATGAAAAACATGCGTACCAAAGTACGACGATTCAAAAAAGAT
TRN  11011101101011000
NAM  Q87NK8_VIBPA/1-167
ASQ  MSSVPKNKDELELAINSIFPKLMVDYRSIPESKARKVGVEGNVKGTFISVSDTVAYLIGWGKLVLKWHRLKSQNQHVDFPETGYKWNQLGLLAESFHEEYRDW-KYSDLLVELEFTINEILLLISSLSDHELYG---VAWY------EQWTLGRMIQFNTSSPMKNMRTKVRRFNRE
DSQ  TTGTCTTCTGTACCAAAAAATAAGGATGAATTGGAGTTAGCCATAAACTCAATATTTCCCAAACTAATGGTCGACTATCGCTCAATCCCTGAAAGTAAAGCCCGCAAAGTCGGCGTAGAAGGGAACGTTAAAGGCACATTCATTAGCGTTAGTGATACAGTCGCTTACTTGATTGGTTGGGGAAAACTCGTTCTAAAATGGCACCGTTTAAAATCTCAAAATCAGCATGTGGATTTTCCTGAAACTGGCTATAAATGGAACCAACTTGGGTTGCTAGCCGAAAGTTTCCACGAAGAATATCGTGACTGG---AAATACAGTGATCTGCTTGTTGAACTAGAGTTTACGATTAACGAGATACTTCTACTCATTTCAAGTTTAAGTGATCATGAGTTGTATGGT---------GTAGCGTGGTAT------------------GAGCAATGGACTCTAGGGCGCATGATTCAGTTTAATACATCATCACCTATGAAAAATATGCGTACAAAAGTTAGGCGTTTCAATCGGGAA
TRN  10010101100011000
NAM  Q6LQQ6_PHOPR/1-167
ASQ  MSSIPQNKDELINAITFVSGRLLDDYRSIPDELSRTIAIEGNVKGTAISVCDTLAYLIGWGKLVLKWYSLQSQGQSVDFPETGYKWNQLGLLAQSFQKDYQNW-DYPSLQSEFTTTTQDILLLVVSLDNHALYG---VCWY------EKWTLGRMIQFNTSSPMKNVRTKVRRFKKI
DSQ  ATGTCATCAATCCCCCAGAATAAAGATGAATTAATCAATGCAATCACCTTTGTATCGGGAAGGTTGTTAGATGATTACCGTTCAATTCCTGATGAATTGTCGAGAACAATTGCGATAGAAGGGAATGTTAAAGGTACGGCTATTAGTGTTTGCGATACGCTTGCATATTTGATTGGCTGGGGGAAGCTTGTCTTGAAGTGGTATTCACTACAATCACAGGGGCAAAGCGTCGATTTCCCAGAGACTGGCTACAAATGGAACCAGCTAGGATTATTGGCACAGAGTTTCCAAAAAGATTATCAAAATTGG---GATTACCCGAGCTTACAAAGTGAATTCACAACGACAACACAAGATATTTTACTGCTAGTGGTTAGTCTTGATAACCATGCTCTTTATGGT---------GTGTGTTGGTAT------------------GAAAAGTGGACGCTTGGACGTATGATTCAGTTTAATACATCATCACCAATGAAAAATGTGCGAACCAAGGTTAGACGATTCAAAAAAATA
TRN  10010101100011000
NAM  Q03036_YEAST/1-167
ASQ  MR-EYTSKKELKEEIEKKYEKYDAEFETISESQK-----DEKVETVDRTPSENLSYQLGWVNLLLEWEAKEIAGYNVETPAPGYKWNNLGGLYQSFYKKYGIY-SIKEQRAKLREAVNEVYKWISTLSDDELFQAGNRKWA---TTKAMWPVYKWIHINTVAPFTNFRGKIRKWKRL
DSQ  ATGAGA---GAATATACCAGTAAAAAAGAACTAAAGGAAGAGATTGAAAAAAAATATGAAAAATATGATGCAGAATTTGAAACAATCTCTGAATCTCAAAAA---------------GACGAAAAAGTTGAAACAGTGGATAGAACACCCTCTGAAAACCTCTCTTATCAATTGGGCTGGGTTAATTTATTATTAGAGTGGGAAGCAAAGGAAATTGCTGGGTATAATGTGGAAACTCCTGCGCCTGGTTATAAATGGAACAATTTAGGAGGATTATACCAGTCATTTTATAAAAAATACGGAATCTAC---TCCATTAAGGAGCAAAGAGCCAAGCTGAGAGAGGCCGTAAACGAGGTCTATAAATGGATATCTACTTTATCTGATGATGAGCTCTTTCAAGCGGGAAATAGAAAATGGGCT---------ACAACTAAAGCTATGTGGCCTGTGTATAAATGGATCCATATCAACACGGTTGCTCCTTTCACAAACTTTAGAGGAAAAATTAGAAAATGGAAGAGACTA
TRN  10010101100011000
NAM  Q839W6_ENTFA/1-167
ASQ  MR-TYESKEALIEAIQIASQKYLAEFAEIPETLK-----DHRIETVAKTPSENLAYQLGWLNLLLSWEEQEQRGLTVQTPAEGYKWNQLGALYQSFYQTYGQM-SLESQLIALQDTLEKLLHWIDSLSEDELFLPQQRAWA---TTKAQWPLWKWIHINSVAPFTSFRTQIRKWKKA
DSQ  ATGCGA---ACCTATGAATCAAAAGAAGCCTTGATTGAGGCCATTCAAATAGCTTCACAAAAATATTTAGCTGAATTTGCAGAAATTCCTGAAACACTTAAA---------------GATCACCGAATTGAAACAGTAGCTAAAACACCTTCAGAGAACTTAGCCTATCAATTAGGTTGGCTCAACTTGCTGCTTTCTTGGGAAGAACAAGAACAACGTGGTCTGACCGTTCAAACGCCAGCTGAAGGCTATAAATGGAATCAACTGGGCGCGCTCTATCAATCATTTTATCAAACCTATGGACAAATG---AGTTTAGAAAGTCAGCTGATTGCGTTGCAAGACACCTTAGAAAAATTACTTCATTGGATTGACTCGCTTTCCGAAGACGAATTATTTTTACCTCAACAACGGGCTTGGGCG---------ACCACCAAAGCACAATGGCCTCTTTGGAAATGGATTCACATTAATAGCGTTGCCCCTTTTACTAGTTTCCGAACGCAAATTCGCAAATGGAAAAAAGCT
TRN  10010101100011000
NAM  Q9CN16_PASMU/1-170
ASQ  MR-HYTSKTALKNAIQQTYEKYLSEFETIPEDLK-----ETGCTEVERTPVQNLAYQVGWTSLLISWEQDERKGLLVKTPSEHFKWNQLSELYQWFNQTYAHL-SLAELKSRLAHNIETIYYLIDTMSDKALFSQHQRKWADNATKNAKWTVFQFIHVNTVAPFTSFRTKIRKWKKH
DSQ  ATGCGT---CATTATACGAGTAAAACGGCTTTAAAAAATGCGATACAACAAACGTATGAGAAATATTTGTCAGAATTTGAAACCATTCCGGAAGATTTAAAA---------------GAGACAGGATGTACAGAGGTTGAGCGAACACCTGTGCAAAACTTAGCTTATCAAGTTGGTTGGACAAGTTTATTGATCAGCTGGGAACAAGATGAACGAAAGGGATTGCTTGTTAAAACCCCTTCTGAACACTTCAAGTGGAATCAATTAAGTGAACTTTATCAATGGTTTAATCAAACTTATGCACATTTG---TCCTTAGCCGAATTAAAAAGTCGATTAGCACATAATATAGAAACAATTTATTATCTAATTGATACCATGAGCGATAAAGCGCTTTTTTCCCAACATCAACGAAAGTGGGCGGATAATGCCACTAAAAATGCCAAATGGACAGTATTTCAATTTATTCATGTGAATACGGTTGCCCCCTTTACGAGCTTTAGAACAAAAATAAGAAAATGGAAGAAACAT
TRN  10010101110011000
NAM  Q8DQ54_STRR6/10-179
ASQ  LR-TYENKEELKAEIEKTFEKYILEFDNIPENLK-----DKRADEVDRTPAENLAYQVGWTNLVLKWEEDERKGLQVKTPSDKFKWNQLGELYQWFTDTYAHL-SLQELKAKLNENINSISAMIDSLSEEELFEPHMRKWADEATKTATWEVYKFIHVNTVAPFGTFRTKIRKWKKI
DSQ  TTGCGA---ACATACGAAAATAAAGAAGAACTAAAAGCTGAGATAGAGAAAACATTTGAGAAATATATTTTAGAATTTGATAATATTCCAGAAAATTTAAAA---------------GATAAGAGAGCTGATGAAGTTGACAGAACTCCAGCAGAAAACCTTGCTTATCAGGTTGGTTGGACCAACTTGGTTCTTAAATGGGAAGAAGATGAAAGAAAGGGGCTTCAAGTAAAAACACCATCGGATAAATTTAAATGGAATCAACTTGGTGAATTATATCAGTGGTTCACAGATACCTACGCTCATTTA---TCTCTGCAAGAGTTGAAAGCAAAATTAAATGAAAATATTAATTCTATCTCTGCAATGATTGATTCGTTGAGTGAGGAAGAATTATTTGAACCGCATATGAGAAAGTGGGCTGATGAAGCGACTAAAACAGCGACTTGGGAAGTGTATAAGTTTATTCATGTAAATACGGTTGCACCTTTTGGAACTTTCAGAACTAAAATCAGAAAATGGAAGAAGATA
TRN  10010101100011010
NAM  Q8DWV2_STRA5/1-170
ASQ  MR-TYSDKNELKEEVLKSYKKYIAEFNDIPEKLK-----DLRIDEVDRTPAENLAYQVGWTTLILKWESDEQSGLEVKTPTETFKWNQLGELYQHFTETYASL-TIKELTAQLNDNVDAIGNMIDSMSDEVLFKPHMRNWADSATKNAVWEVYKFIHINTVAPFGTFRTKIRKWKKV
DSQ  ATGAGA---ACATATTCAGATAAAAACGAACTTAAGGAAGAAGTACTAAAATCATATAAAAAATATATTGCTGAATTCAATGACATTCCTGAGAAGTTGAAA---------------GATTTAAGAATTGATGAGGTTGATAGGACACCAGCGGAGAATCTAGCCTATCAGGTTGGCTGGACTACCCTGATACTAAAATGGGAGTCAGATGAACAGAGTGGCTTAGAAGTTAAAACACCAACTGAGACGTTTAAATGGAATCAACTTGGAGAGCTATATCAGCATTTTACTGAGACCTACGCTAGTCTA---ACCATCAAAGAACTTACGGCTCAACTCAATGATAATGTAGATGCTATAGGTAACATGATTGATTCAATGAGCGACGAAGTCCTATTTAAACCTCATATGAGAAATTGGGCTGATAGTGCGACTAAGAATGCAGTCTGGGAAGTTTATAAGTTTATTCATATTAATACGGTAGCTCCTTTCGGAACATTTAGAACTAAGATTCGCAAGTGGAAAAAAGTT
TRN  10010101100011000
NAM  Q8RFR2_FUSNN/11-180
ASQ  MK-EYTSKVELTSAIKASYKKYIDEFENISEDLK-----DKRFEKVDRTPAENLAYQVGWTTLLLKWEKDEKAGLEVHTPSENFKWNNLTELYKWFNKEYSHL-SLAELKSILNKNISDIYKMIDEMSEDELFKPHQRKWADNSTKTAVWEVCKFIHINTVAPFGTFRTKIRKWKKL
DSQ  ATGAAG---GAATACACATCAAAAGTAGAATTAACAAGTGCAATTAAGGCTTCATACAAAAAATATATTGATGAATTTGAAAATATATCAGAAGATTTAAAA---------------GATAAAAGATTTGAAAAAGTTGATAGAACTCCTGCTGAAAATTTAGCTTATCAAGTTGGCTGGACAACTTTACTTTTAAAATGGGAAAAGGATGAAAAAGCTGGTTTAGAAGTTCATACACCTAGTGAAAATTTTAAATGGAATAATTTAACTGAATTATATAAATGGTTTAATAAAGAATATTCTCATTTA---TCCTTAGCTGAATTGAAATCTATTTTAAATAAAAATATTTCTGATATTTATAAGATGATAGATGAAATGTCCGAAGATGAATTATTTAAACCACATCAAAGAAAATGGGCAGATAACTCAACTAAAACTGCTGTTTGGGAAGTATGTAAATTTATTCATATAAATACTGTTGCACCCTTTGGAACTTTTAGAACAAAAATTAGAAAATGGAAAAAACTT
TRN  10010101110011000
NAM  Q71WY9_LISMF/1-166
ASQ  MV-RPKNKVELLQQSTEKYQQLNDLINSIPKEKQ---QLTFPFEDRDKNIRDVVIHLHEWHKMALDWYEVGMGGKKPLMPAEGYTWKTTPELNLVIWQKYQET-DLAQARELLDETHNKEMVLIAGHSEEELFTKKYYKWT------NTTSLGAIFISSTSSHYDWAIKKIRKFKKA
DSQ  ATGGTA---AGACCAAAGAACAAAGTAGAATTACTTCAACAAAGCACGGAAAAGTACCAACAATTGAACGATTTAATCAACTCTATTCCAAAAGAAAAGCAA---------CAGCTCACGTTTCCATTTGAAGACCGGGATAAAAATATTCGGGATGTCGTAATACATTTGCACGAATGGCATAAGATGGCGCTGGATTGGTATGAAGTTGGAATGGGTGGAAAGAAACCATTGATGCCAGCAGAAGGTTATACGTGGAAAACGACACCAGAGCTAAATTTGGTCATTTGGCAGAAATACCAAGAGACT---GATTTAGCGCAAGCAAGGGAATTACTGGATGAAACCCATAACAAAGAAATGGTTTTAATTGCAGGGCATTCGGAGGAAGAACTATTTACAAAAAAATATTATAAATGGACC------------------AATACAACTTCACTAGGCGCCATTTTTATTTCAAGCACATCAAGTCATTACGACTGGGCGATTAAAAAAATACGGAAATTCAAGAAAGCC
TRN  10010101100011000
NAM  Q73PY6_TREDE/1-166
ASQ  MP-RPTTKEDLIFASNEQFEKLWNLIDGMTEKER---TADINPNERDKNVRDVLVHLYEWHCLLLNWIKSNTKGKPAAFLPEAYNWKTYPEMNVEFWKKHQGT-PYADAEKMLKKTHKEVMKLIETFSNEELFSKAVFNWT------GTTTLGSYCVSATSSHYDWAIKDIKKALKK
DSQ  ATGCCG---AGACCTACAACAAAAGAAGATTTGATTTTTGCTTCAAATGAGCAGTTTGAAAAACTGTGGAACTTAATTGACGGTATGACCGAAAAAGAAAGA---------ACTGCCGATATAAATCCAAACGAGCGCGATAAAAATGTACGCGATGTGTTGGTTCATCTTTATGAATGGCACTGTCTTTTATTGAATTGGATAAAATCCAACACAAAAGGAAAACCGGCAGCCTTTTTGCCTGAAGCTTACAACTGGAAAACTTATCCTGAAATGAATGTTGAGTTTTGGAAAAAACATCAAGGCACC---CCTTATGCCGATGCCGAAAAAATGCTTAAAAAAACTCATAAAGAAGTTATGAAACTAATCGAAACCTTTTCCAATGAGGAACTTTTTTCAAAAGCTGTTTTTAACTGGACA------------------GGTACAACGACCCTCGGAAGTTACTGCGTGTCCGCTACTTCCAGCCATTATGACTGGGCTATAAAGGATATAAAAAAAGCATTGAAAAAA
TRN  10010101100011000
//