EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07882 - Fucose_iso_N2)
FAM  PF07882
PID  Fucose_iso_N2
DES  L-fucose isomerase, second N-terminal domain
ANO  7
ALN  189
AID  0.506215
APH  ((((FUCI_VIBVY/173-351:0.17264,(FUCI_HAEIN/178-358:0.18788,FUCI_SHIFL/175-355:0.42307):0.07866):0.08041,FUCI_CLOPE/173-359:0.52487):0.04645,FUCI_BACTN/173-356:0.21761):0.09801,Q9WYE3_THEMA/160-316:1.41693,FUCI_STRR6/173-353:0.12638);
ATP  ((((FUCI_VIBVY/173-351,(FUCI_HAEIN/178-358,FUCI_SHIFL/175-355)),FUCI_CLOPE/173-359),FUCI_BACTN/173-356),Q9WYE3_THEMA/160-316,FUCI_STRR6/173-353);
ATL  3.37287
DNO  6
DLN  567
DID  0.540383
DPH  ((((FUCI_VIBVY/173-351:0.20206,FUCI_SHIFL/175-355:0.35168):0.06290,FUCI_BACTN/173-356:0.19460):0.06072,Q9WYE3_THEMA/160-316:0.94771):0.03424,FUCI_CLOPE/173-359:0.47606,FUCI_STRR6/173-353:0.18422);
DTP  ((((FUCI_VIBVY/173-351,FUCI_SHIFL/175-355),FUCI_BACTN/173-356),Q9WYE3_THEMA/160-316),FUCI_CLOPE/173-359,FUCI_STRR6/173-353);
DTL  2.51401
RID  0.485232
RPH  ((((FUCI_VIBVY/173-351:0.16643,FUCI_SHIFL/175-355:0.44836):0.06993,FUCI_CLOPE/173-359:0.52519):0.05389,FUCI_BACTN/173-356:0.19896):0.09690,Q9WYE3_THEMA/160-316:1.41482,FUCI_STRR6/173-353:0.13991);
RTP  ((((FUCI_VIBVY/173-351,FUCI_SHIFL/175-355),FUCI_CLOPE/173-359),FUCI_BACTN/173-356),Q9WYE3_THEMA/160-316,FUCI_STRR6/173-353);
RTL  3.08993
LNK  FUCI_BACTN/173-356:Q9RQ13:AF137263
LNK  FUCI_CLOPE/173-359:Q8XNL5:BA000016
LNK  FUCI_HAEIN/178-358:P44779:
LNK  FUCI_SHIFL/175-355:P69923:AE015295
LNK  FUCI_STRR6/173-353:Q8DN24:AE008561
LNK  FUCI_VIBVY/173-351:Q7MJI2:BA000037
LNK  Q9WYE3_THEMA/160-316:Q9WYE3:AE001712
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  FUCI_SHIFL/175-355
ASQ  KSYLSLGGVSMGIAGSIVDHNFFESWLGMKVQAVDMTELRRRIDQKIYDEAELEMALAWADKNFR--YGED-ENNKQYQRNAEQS-----RAVLRESLLMAMCIRDMMQGNSKLADIGRVEESLGYNAIAAGFQGQRHWTDQYPNGDTAEAILNSSFDWNGVREPFVVATENDSLNGVAMLMGHQLTGT
DSQ  AAAAGCTATCTGTCGCTGGGCGGCGTTTCGATGGGTATCGCCGGTTCTATTGTTGATCACAACTTCTTTGAATCCTGGCTGGGAATGAAAGTCCAGGCGGTGGATATGACCGAACTGCGTCGCCGTATCGATCAGAAGATTTACGACGAAGCCGAACTGGAAATGGCACTGGCCTGGGCTGATAAAAACTTCCGC------TATGGCGAAGAT---GAAAATAACAAACAGTATCAACGCAATGCCGAGCAAAGC---------------CGCGCAGTTCTGCGCGAAAGTTTACTGATGGCGATGTGTATCCGCGACATGATGCAAGGCAACAGCAAACTGGCCGATATTGGTCGCGTGGAAGAATCACTTGGCTACAACGCCATCGCTGCGGGCTTCCAGGGGCAACGTCACTGGACCGATCAATATCCCAATGGTGACACCGCCGAAGCGATCCTCAACAGTTCATTTGACTGGAATGGCGTGCGCGAACCCTTTGTCGTGGCGACCGAAAACGACAGTCTTAACGGCGTGGCAATGCTAATGGGTCACCAGCTCACCGGCACC
TRN  11011101101011000
NAM  FUCI_BACTN/173-356
ASQ  KSYLSMGSVSMGIAGSIVNPDFFQEYLGMRNESIDLTEIIRRMEEGIYDHEEYAKAMAWTEKYCKVNEGEDFKNRPEKRKKREQK-----DADWEFVVKMMIIMRDLMTGNPKLKEMGFKEEALGHNAIAAGFQGQRQWTDFYPNGDYPEALLNTSFDWNGIREAFVVATENDACNGVAMLFGHLLTNR
DSQ  AAATCTTATCTGTCAATGGGTAGTGTATCAATGGGTATCGCCGGCTCTATTGTCAACCCCGACTTCTTCCAGGAATATCTGGGAATGCGCAATGAGTCAATTGACCTGACGGAAATCATCCGCCGCATGGAAGAAGGTATCTATGACCACGAAGAATATGCCAAAGCAATGGCATGGACTGAAAAATACTGCAAAGTAAATGAAGGAGAAGACTTCAAGAACCGCCCGGAGAAACGCAAAAAGCGCGAACAAAAA---------------GATGCTGACTGGGAATTTGTCGTGAAGATGATGATCATCATGCGTGACCTGATGACCGGAAACCCGAAACTGAAAGAAATGGGATTCAAGGAAGAAGCTTTGGGACACAATGCTATCGCTGCCGGCTTCCAGGGACAACGCCAATGGACAGACTTTTATCCTAACGGTGACTATCCGGAAGCATTGCTCAACACTTCTTTCGACTGGAACGGTATTCGTGAAGCATTCGTAGTGGCTACCGAAAACGATGCTTGTAACGGTGTAGCAATGCTGTTCGGACACTTGCTGACCAATCGT
TRN  11011101101011001
NAM  FUCI_STRR6/173-353
ASQ  TAYLSMGSVSMGIGGSIVNPDFFQEYLGMRNESVDMTEFTRRMDRGIYDPEEFERALKWVKENVK--EGFD-HNREDLVLSREEK-----DRQWEFVIKMFMIGRDLMVGNPRLAELGFEEEAVGHHALVAGFQGQRQWTDHFPNGDFMETFLNTQFDWNGIRKPFVFATENDSLNGVSMLFNYLLTNT
DSQ  ACTGCTTACCTATCAATGGGTAGTGTTTCGATGGGGATTGGCGGTTCTATTGTAAATCCAGATTTCTTCCAAGAATACTTAGGAATGCGAAATGAATCGGTAGATATGACGGAGTTCACGCGCCGTATGGACCGTGGTATTTACGACCCTGAAGAGTTCGAACGTGCGCTCAAATGGGTGAAAGAAAACGTAAAA------GAAGGATTCGAC---CATAACCGTGAAGACCTTGTTTTAAGCCGTGAAGAAAAA---------------GATAGACAATGGGAATTTGTTATTAAGATGTTCATGATTGGACGTGACTTAATGGTTGGTAACCCAAGACTTGCTGAACTTGGTTTTGAGGAAGAAGCAGTTGGTCACCATGCTTTAGTAGCTGGTTTCCAAGGTCAACGTCAGTGGACAGACCATTTTCCAAATGGGGACTTTATGGAAACTTTCCTCAATACTCAGTTTGACTGGAATGGTATTCGAAAACCATTTGTATTTGCGACAGAGAATGATTCACTAAATGGTGTGTCTATGCTCTTTAATTATCTATTAACAAATACT
TRN  10010101110011000
NAM  FUCI_VIBVY/173-351
ASQ  KSYLSMGSVSMGIAGSIVDQPFFQHYLGMRNEYVDMTEIKRRLDREIFDKEEFELAMAWTKEHCH--EGKD-YNREPMSEARK-------QEDWQTVVKMTMIMRDLMEGNPKLAEMGFGEEALGHNAVVGGFQGQRHWTDHLPNGDFSEAILNSSFDWNGIREPFVIATENDSLNGVNMLFGKMLTGQ
DSQ  AAATCTTACCTATCCATGGGTTCGGTCTCTATGGGTATCGCAGGCTCGATTGTTGATCAACCCTTCTTCCAGCACTACCTAGGTATGCGTAATGAATACGTGGATATGACGGAAATCAAACGCCGCCTAGACCGAGAGATCTTCGATAAAGAAGAGTTCGAGTTAGCGATGGCGTGGACGAAAGAGCATTGCCAT------GAAGGTAAAGAT---TACAACCGTGAGCCAATGAGTGAAGCGCGTAAA---------------------CAGGAAGATTGGCAGACAGTGGTTAAGATGACGATGATCATGCGCGATCTGATGGAAGGTAACCCTAAACTGGCGGAAATGGGCTTCGGTGAAGAAGCACTCGGTCATAACGCCGTCGTGGGAGGCTTCCAAGGCCAGCGTCATTGGACAGACCATCTGCCAAATGGTGACTTTAGTGAGGCGATCCTTAACTCTTCGTTTGACTGGAATGGCATTCGTGAACCGTTTGTGATTGCGACTGAAAACGACAGCCTCAATGGCGTTAACATGCTGTTTGGCAAGATGTTGACAGGTCAA
TRN  11011101101011010
NAM  FUCI_HAEIN/178-358
ASQ  KSYLSIGSVSMGIAGSIVNQAFFQEYLGMRNEYVDMMEIKRRLDRKIYDQEEVDLALSWVKQYCK--EGVD-VNSLENQRNAEER-----AELWENVVKMTIITRDLMVGNPKLATLNYAEEALGHNAIAAGFQGQRHWTDHLPNGDFMEAMLNSTYDWNGVRPPYILATENDSLNAIGMLFGHQLTGK
NAM  FUCI_CLOPE/173-359
ASQ  KSYVNIGASSMGIAGSQVDISFFEDYLGMLVEFVDMTEILRRIHLEIFDPIEYDKALNWIKENCR--EGIDINEGKDLPDIVKKSKVIPADKDWEFIAKQAIIIRDILYRNEKLGDLGWEEEARGRNAIAGGFQGQRQWTDWLPNGDFTEAIMASTFDWNGPRQVTAFATENDTLNGVSMLLGTLLTNK
DSQ  AAGTCTTATGTGAATATTGGGGCTTCATCTATGGGAATTGCAGGTTCACAAGTAGATATAAGTTTTTTTGAAGACTATTTAGGAATGCTAGTTGAGTTTGTTGATATGACAGAGATTTTGCGCCGTATTCATTTAGAAATTTTTGATCCAATAGAATATGATAAAGCTTTAAATTGGATTAAGGAGAATTGTCGT------GAAGGTATAGATATAAATGAAGGAAAAGATTTACCTGACATTGTGAAAAAATCAAAAGTTATTCCAGCGGATAAGGATTGGGAGTTTATTGCAAAACAAGCTATTATTATTCGAGATATTTTATATAGGAATGAAAAGTTAGGAGATTTAGGTTGGGAAGAAGAGGCAAGAGGTAGAAATGCTATAGCAGGAGGATTTCAAGGACAAAGACAGTGGACTGATTGGTTACCTAATGGTGATTTTACTGAAGCGATTATGGCTTCTACCTTTGATTGGAATGGACCTAGACAGGTAACAGCTTTTGCTACTGAAAATGATACATTAAATGGTGTTTCCATGTTATTAGGAACATTACTTACTAATAAA
TRN  10010101110011000
NAM  Q9WYE3_THEMA/160-316
ASQ  QRYGVFGGRSMGMYTAVPNVDLWNKIFGVDVEHIDQFEIVRRSQ--LIPDERARKGRLWIEEKAKAVH----YDGKYLT-----------PEKLELQIKSYHAVREIVEE----MELDF-----------VGIKGQLELTEHFVTMDVTETFLNDPYDWEGEHEPIVCATEADSDGALTMQIFKLIAKT
DSQ  CAGAGATACGGTGTGTTCGGTGGAAGATCGATGGGTATGTACACCGCCGTTCCTAACGTGGATCTGTGGAACAAGATCTTCGGTGTCGATGTAGAGCACATAGACCAGTTCGAGATCGTTCGAAGAAGCCAG------CTGATACCGGACGAGCGCGCAAGGAAAGGAAGGCTCTGGATCGAAGAGAAAGCAAAAGCGGTTCAC------------TACGATGGGAAGTACCTCACA---------------------------------CCCGAAAAGCTCGAACTCCAGATAAAGAGCTATCATGCGGTGAGGGAGATCGTGGAGGAG------------ATGGAATTAGACTTT---------------------------------GTGGGAATAAAAGGCCAGCTCGAACTCACAGAACACTTCGTGACGATGGATGTGACGGAGACGTTCCTGAACGATCCCTACGACTGGGAAGGAGAGCACGAACCGATCGTGTGCGCAACAGAGGCAGATTCCGATGGGGCGCTCACGATGCAGATCTTCAAGCTGATTGCGAAAACA
TRN  10010101100011010
//