EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07878 - DUF1662)
FAM  PF07878
PID  DUF1662
DES  Protein of unknown function (DUF1662)
ANO  11
ALN  72
AID  0.256588
APH  (((((Q7VCC6_PROMA/12-81:0.47888,(Q7U397_PROMP/14-82:0.82224,Q7TUZ5_PROMM/12-81:0.11617):0.09268):0.42544,Q7V7A3_PROMM/12-81:0.16386):0.29987,Q7U7V4_SYNPX/2-71:0.40150):0.95170,((Q7U4A0_SYNPX/12-78:0.23341,(Q7V3I9_PROMP/12-82:0.38799,Q7VEB2_PROMA/12-83:0.25496):0.13925):0.18540,Q7V5D3_PROMM/12-82:0.05577):1.66563):1.84140,Q7TV19_PROMM/2-72:0.00000,Q7U858_SYNPX/9-77:0.60548);
ATP  (((((Q7VCC6_PROMA/12-81,(Q7U397_PROMP/14-82,Q7TUZ5_PROMM/12-81)),Q7V7A3_PROMM/12-81),Q7U7V4_SYNPX/2-71),((Q7U4A0_SYNPX/12-78,(Q7V3I9_PROMP/12-82,Q7VEB2_PROMA/12-83)),Q7V5D3_PROMM/12-82)),Q7TV19_PROMM/2-72,Q7U858_SYNPX/9-77);
ATL  9.07574
DNO  11
DLN  216
DID  0.373597
DPH  (((((Q7V7A3_PROMM/12-81:0.25806,Q7U7V4_SYNPX/2-71:0.54029):0.17959,Q7TUZ5_PROMM/12-81:0.16984):0.19827,(Q7U397_PROMP/14-82:0.46430,Q7VCC6_PROMA/12-81:0.35467):0.04722):1.35518,(Q7U4A0_SYNPX/12-78:0.02453,((Q7V3I9_PROMP/12-82:0.35545,Q7VEB2_PROMA/12-83:0.26210):0.24079,Q7V5D3_PROMM/12-82:0.19363):0.34967):0.81205):0.20354,Q7TV19_PROMM/2-72:0.10073,Q7U858_SYNPX/9-77:0.53397);
DTP  (((((Q7V7A3_PROMM/12-81,Q7U7V4_SYNPX/2-71),Q7TUZ5_PROMM/12-81),(Q7U397_PROMP/14-82,Q7VCC6_PROMA/12-81)),(Q7U4A0_SYNPX/12-78,((Q7V3I9_PROMP/12-82,Q7VEB2_PROMA/12-83),Q7V5D3_PROMM/12-82))),Q7TV19_PROMM/2-72,Q7U858_SYNPX/9-77);
DTL  6.20702
RID  0.256588
RPH  (((((Q7VCC6_PROMA/12-81:0.47888,(Q7U397_PROMP/14-82:0.82224,Q7TUZ5_PROMM/12-81:0.11617):0.09268):0.42544,Q7V7A3_PROMM/12-81:0.16386):0.29987,Q7U7V4_SYNPX/2-71:0.40150):0.95170,((Q7U4A0_SYNPX/12-78:0.23341,(Q7V3I9_PROMP/12-82:0.38799,Q7VEB2_PROMA/12-83:0.25496):0.13925):0.18540,Q7V5D3_PROMM/12-82:0.05577):1.66563):1.84140,Q7TV19_PROMM/2-72:0.00000,Q7U858_SYNPX/9-77:0.60548);
RTP  (((((Q7VCC6_PROMA/12-81,(Q7U397_PROMP/14-82,Q7TUZ5_PROMM/12-81)),Q7V7A3_PROMM/12-81),Q7U7V4_SYNPX/2-71),((Q7U4A0_SYNPX/12-78,(Q7V3I9_PROMP/12-82,Q7VEB2_PROMA/12-83)),Q7V5D3_PROMM/12-82)),Q7TV19_PROMM/2-72,Q7U858_SYNPX/9-77);
RTL  9.07574
LNK  Q7TUZ5_PROMM/12-81:Q7TUZ5:BX572097
LNK  Q7TV19_PROMM/2-72:Q7TV19:BX572096
LNK  Q7U397_PROMP/14-82:Q7U397:BX572091
LNK  Q7U4A0_SYNPX/12-78:Q7U4A0:BX569694
LNK  Q7U7V4_SYNPX/2-71:Q7U7V4:BX569691
LNK  Q7U858_SYNPX/9-77:Q7U858:BX569691
LNK  Q7V3I9_PROMP/12-82:Q7V3I9:BX572090
LNK  Q7V5D3_PROMM/12-82:Q7V5D3:BX572099
LNK  Q7V7A3_PROMM/12-81:Q7V7A3:BX572097
LNK  Q7VCC6_PROMA/12-81:Q7VCC6:AE017163
LNK  Q7VEB2_PROMA/12-83:Q7VEB2:AE017161
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q7VEB2_PROMA/12-83
ASQ  QKSPRVQVVLPEELCAQLTFLAKKESRTVSNMAKVLIQEGVDSLITEYLSKSEESTNTSHTESFRSSLETQQ
DSQ  CAAAAGTCTCCCAGGGTGCAAGTTGTGCTTCCAGAGGAGCTATGCGCTCAGCTAACTTTTTTAGCCAAAAAAGAATCCAGAACAGTCAGCAATATGGCAAAAGTTCTTATCCAAGAAGGAGTTGATAGCTTAATAACTGAATATCTATCCAAGAGCGAAGAAAGTACAAACACAAGCCATACAGAAAGTTTCAGGTCTTCTTTAGAGACCCAACAA
TRN  10010101110011010
NAM  Q7V5D3_PROMM/12-82
ASQ  PKSPRVQVVLPEELCVRLTALAELESRTVSNMAKVLIQQGIQRYEQEQSSV-VSAPSLASTEGFRSALEAQQ
DSQ  CCCAAGTCTCCGAGAGTCCAGGTTGTGTTGCCTGAAGAGCTTTGTGTGCGCCTAACAGCTCTTGCCGAGCTTGAGTCCCGCACCGTTAGCAATATGGCCAAAGTGCTTATTCAGCAGGGTATTCAGCGTTACGAGCAGGAGCAGAGTTCGGTC---GTTTCAGCCCCATCGTTAGCGAGTACAGAAGGCTTTCGATCGGCTCTTGAAGCTCAACAG
TRN  10010101110011000
NAM  Q7U4A0_SYNPX/12-78
ASQ  PKSPRIQVVLPEDLCARLTALADQESRTVSNMARVLIQQGV-----QRHEQSAEAPLPSREERLRSALESQQ
DSQ  CCCAAATCCCCGCGGATTCAGGTGGTCCTGCCAGAGGATCTCTGTGCCCGTTTGACGGCCTTGGCTGATCAGGAGTCACGCACGGTCAGCAACATGGCGCGGGTGCTGATCCAGCAGGGAGTC---------------CAGAGGCATGAACAGAGTGCTGAGGCGCCGCTGCCCTCAAGGGAAGAGCGGTTGCGCTCCGCCCTTGAGTCGCAGCAA
TRN  10010101100011001
NAM  Q7V3I9_PROMP/12-82
ASQ  PKSPRIQVVLPELICEQLNILAENESRTVSNMAKVLIQQGIKNHLK-REAKSQTSDTAVNTENFRDTLERQS
DSQ  CCAAAATCCCCTAGAATACAGGTGGTTCTTCCAGAATTGATTTGTGAGCAACTAAATATTTTAGCTGAGAATGAATCAAGAACTGTCAGCAATATGGCCAAGGTATTAATTCAGCAAGGAATTAAAAATCATCTCAAA---AGAGAAGCCAAATCACAAACATCAGATACTGCAGTTAATACTGAGAATTTCCGGGATACATTAGAAAGACAAAGT
TRN  10010101110011000
NAM  Q7VCC6_PROMA/12-81
ASQ  SKSTHDAIIDQLRACNTPSEILAFEKWFDNTVNVGPLYTVICDLLRNRSISRCTASKWFET--LLKSRDEKL
DSQ  AGTAAAAGTACTCATGATGCAATTATTGATCAGTTGCGTGCATGTAATACTCCCTCCGAAATATTGGCATTTGAGAAGTGGTTTGATAACACAGTTAATGTAGGTCCTCTTTACACAGTTATATGTGATCTACTTAGGAATAGATCTATTTCTAGGTGCACAGCTTCAAAATGGTTTGAAACC------TTACTAAAAAGCAGAGATGAAAAGCTA
TRN  10010101110011000
NAM  Q7TUZ5_PROMM/12-81
ASQ  SKSTREAIVDKLRACQTDEQLLAYDAQFNIESNTGPLYLVICEFLHNRTISRAIAAKWLRT--LLEDRENKL
DSQ  AGTAAAAGCACACGCGAAGCAATAGTCGACAAACTCAGGGCTTGTCAAACAGATGAGCAGTTACTTGCATACGATGCTCAATTCAATATTGAATCCAATACAGGCCCCTTATATCTGGTGATTTGCGAATTTCTACATAATCGCACCATCTCTCGTGCGATCGCCGCCAAGTGGCTAAGGACA------CTACTGGAAGACCGCGAAAATAAACTT
TRN  10010101100011010
NAM  Q7U397_PROMP/14-82
ASQ  NDSSTHALVDVLRKRNTEESILEFEEKFNSRNEKN-LHIYICRFLKNRSISRALASKWLIT--MINDKESKI
DSQ  AATGATTCATCTACTCATGCTTTAGTAGACGTGCTTAGGAAAAGAAATACAGAAGAATCAATATTAGAATTTGAAGAGAAATTTAACTCTAGAAACGAAAAAAAT---CTACATATTTATATATGTAGATTTCTTAAAAATAGATCTATATCTCGAGCTTTAGCTTCTAAGTGGCTAATTACA------ATGATTAACGACAAAGAGTCAAAAATT
TRN  10010101110011000
NAM  Q7V7A3_PROMM/12-81
ASQ  INRMREAIVDQLRSCSTPEQLLALDEQIRVETDAGPLYRLICNFLRDRTVAPVEAARWLDT--LMDHREKQL
DSQ  ATCAACAGAATGCGCGAAGCCATCGTGGATCAACTTCGTTCTTGCAGTACACCTGAGCAGCTTCTAGCGCTAGATGAGCAAATAAGAGTCGAGACCGATGCAGGCCCGCTTTATCGCCTGATCTGCAACTTCCTGCGAGATCGAACGGTTGCTCCCGTCGAAGCAGCGAGATGGCTTGACACC------TTGATGGACCATCGAGAGAAGCAACTG
TRN  10010101100011011
NAM  Q7U7V4_SYNPX/2-71
ASQ  ASDLKERVLSALRACRSSDDLVALDEQLAIDCRDAPLHQVICDALRDRSVAPVEAANWLTT--LMEHRNQQL
DSQ  GCGAGTGACTTGAAAGAGCGTGTGCTCAGTGCCCTGCGCGCTTGCCGAAGCTCGGACGATTTGGTGGCCTTGGATGAGCAATTGGCCATTGATTGTCGCGACGCCCCCTTGCACCAAGTGATCTGCGATGCCCTTCGGGATCGCAGTGTGGCCCCGGTGGAAGCCGCCAATTGGTTGACGACG------CTGATGGAGCACCGTAACCAGCAGCTC
TRN  11011101101011011
NAM  Q7U858_SYNPX/9-77
ASQ  QELQQRLEGQAPAPSSAAVADASSSERINVTLPRGVMDELKRHALEEGRSCGNLAA-YLVEEALRRHRPL--
DSQ  CAGGAGCTGCAACAACGGCTTGAAGGGCAGGCTCCGGCACCCAGCAGCGCTGCCGTAGCTGATGCCTCCAGTTCAGAGCGCATCAACGTCACTCTGCCTCGCGGTGTCATGGACGAACTCAAACGCCATGCCCTGGAGGAGGGCCGCAGTTGCGGCAATCTGGCCGCT---TACCTGGTGGAGGAAGCTTTGCGCCGCCATCGCCCGCTG------
TRN  11011101101011001
NAM  Q7TV19_PROMM/2-72
ASQ  AELQERQRFSQEAPSAAMVADSAQSERLNVTLPVGLMNRLKQHALAESRSCSSLAS-FLIEDGLRRHRQLDG
DSQ  GCCGAGCTGCAAGAGCGCCAACGATTCTCTCAAGAGGCTCCAAGTGCAGCAATGGTGGCGGATTCTGCTCAATCGGAACGCCTCAATGTGACCCTGCCGGTGGGTTTGATGAATCGGCTCAAGCAGCATGCCCTTGCAGAAAGCCGTAGCTGTAGCAGCCTTGCCTCG---TTCTTGATTGAAGATGGACTGCGTCGTCATCGTCAGTTAGACGGG
TRN  11011111101111110
//