EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07835 - COX4_pro_2)
FAM  PF07835
PID  COX4_pro_2
DES  Bacterial aa3 type cytochrome c oxidase subunit IV
ANO  7
ALN  48
AID  0.347679
APH  (((((Q92LZ6_RHIME/4-50:0.27613,Q8U4V6_AGRT5/129-175:0.24737):0.19652,Q8FV73_BRUSU/4-51:0.17718):0.37973,Q6N267_RHOPA/4-50:0.95394):0.26301,Q9A398_CAUCR/5-45:0.62218):0.33697,COX4_PARDE/3-49:0.55305,Q8KRK5_RHOSH/14-61:0.25343);
ATP  (((((Q92LZ6_RHIME/4-50,Q8U4V6_AGRT5/129-175),Q8FV73_BRUSU/4-51),Q6N267_RHOPA/4-50),Q9A398_CAUCR/5-45),COX4_PARDE/3-49,Q8KRK5_RHOSH/14-61);
ATL  4.25945
DNO  7
DLN  144
DID  0.51602
DPH  (Q92LZ6_RHIME/4-50:0.22786,(Q8FV73_BRUSU/4-51:0.25549,Q8U4V6_AGRT5/129-175:0.18850):0.05394,(Q6N267_RHOPA/4-50:0.43540,((COX4_PARDE/3-49:0.29899,Q8KRK5_RHOSH/14-61:0.31961):0.12366,Q9A398_CAUCR/5-45:0.39749):0.15756):0.15670);
DTP  (Q92LZ6_RHIME/4-50,(Q8FV73_BRUSU/4-51,Q8U4V6_AGRT5/129-175),(Q6N267_RHOPA/4-50,((COX4_PARDE/3-49,Q8KRK5_RHOSH/14-61),Q9A398_CAUCR/5-45)));
DTL  2.6152
RID  0.347679
RPH  (((((Q92LZ6_RHIME/4-50:0.27613,Q8U4V6_AGRT5/129-175:0.24737):0.19652,Q8FV73_BRUSU/4-51:0.17718):0.37973,Q6N267_RHOPA/4-50:0.95394):0.26301,Q9A398_CAUCR/5-45:0.62218):0.33697,COX4_PARDE/3-49:0.55305,Q8KRK5_RHOSH/14-61:0.25343);
RTP  (((((Q92LZ6_RHIME/4-50,Q8U4V6_AGRT5/129-175),Q8FV73_BRUSU/4-51),Q6N267_RHOPA/4-50),Q9A398_CAUCR/5-45),COX4_PARDE/3-49,Q8KRK5_RHOSH/14-61);
RTL  4.25945
LNK  COX4_PARDE/3-49:P77921:Y08372
LNK  Q6N267_RHOPA/4-50:Q6N267:BX572606
LNK  Q8FV73_BRUSU/4-51:Q8FV73:AE014292
LNK  Q8KRK5_RHOSH/14-61:Q8KRK5:AF530915
LNK  Q8U4V6_AGRT5/129-175:Q8U4V6:AE008345
LNK  Q92LZ6_RHIME/4-50:Q92LZ6:AL591792
LNK  Q9A398_CAUCR/5-45:Q9A398:AE005993
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9A398_CAUCR/5-45
ASQ  YH-------RGEMDIQEQAATYDAFGKMTKWGSLAISVLLLFFTLLFC
DSQ  TATCAC---------------------CGCGGTGAAATGGACATCCAAGAACAAGCTGCCACCTACGACGCGTTCGGCAAGATGACCAAGTGGGGCTCGCTGGCCATTTCGGTCCTGCTGCTCTTCTTCACCCTGCTGTTCTGC
TRN  11011111101111111
NAM  Q8KRK5_RHOSH/14-61
ASQ  HSHPAHGHVAGSMDITQQEKTFAGFVRMVTWAAVVIVAALIFLALANA
DSQ  CACTCGCATCCCGCTCACGGGCATGTGGCAGGCTCGATGGACATCACCCAGCAGGAGAAGACCTTCGCGGGCTTCGTCCGGATGGTGACATGGGCCGCCGTGGTCATCGTCGCGGCCCTGATCTTCCTCGCGCTGGCCAACGCC
TRN  11011111101111111
NAM  COX4_PARDE/3-49
ASQ  HH-EITDHKHGEMDIRHQQATFAGFIKGATWVSILSIAVLVFLALANS
DSQ  CATCAC---GAAATCACCGATCACAAGCACGGCGAAATGGACATCCGTCATCAGCAGGCGACCTTTGCCGGCTTCATCAAGGGCGCGACCTGGGTCAGCATCCTTTCCATAGCCGTGCTGGTGTTCCTGGCCCTGGCCAACTCC
TRN  10010111100111011
NAM  Q92LZ6_RHIME/4-50
ASQ  HH-SGPVETGAPMDYSEHEKTYDFFISATKYGTLFCVALLIAMAAAFF
DSQ  CATCAT---TCGGGACCGGTCGAAACGGGCGCTCCGATGGACTATTCCGAGCATGAGAAGACATATGATTTCTTCATCAGCGCCACGAAATACGGCACTCTGTTTTGCGTCGCGCTGCTGATTGCGATGGCTGCTGCTTTCTTC
TRN  11011101101011011
NAM  Q8U4V6_AGRT5/129-175
ASQ  HH-TGPVEVGAEMNYAEHEKTYNGFLAMTKYGTMLLCVLMLAMVAGFF
DSQ  CATCAC---ACGGGTCCGGTCGAAGTTGGTGCCGAGATGAACTACGCCGAGCATGAAAAGACCTATAACGGTTTTCTGGCCATGACGAAGTATGGCACCATGCTGCTATGCGTGCTGATGCTGGCCATGGTCGCAGGTTTCTTC
TRN  11011111101111111
NAM  Q8FV73_BRUSU/4-51
ASQ  HHTTAPAELGAPMDYAEHEKTYAGFAGLVKWATVVLVALMIAMAFGFF
DSQ  CATCATACGACAGCTCCGGCTGAACTTGGCGCACCGATGGACTATGCTGAGCATGAGAAAACTTATGCCGGTTTTGCGGGCTTGGTGAAATGGGCCACAGTGGTGCTCGTTGCCCTTATGATTGCCATGGCATTCGGCTTCTTT
TRN  11011101111011011
NAM  Q6N267_RHOPA/4-50
ASQ  HH-EFAYTTADGNDYAAHEQTYEGFIKLVKYGTAAVIVIVALMGIFLT
DSQ  CACCAC---GAGTTTGCCTACACGACTGCCGATGGCAATGACTACGCCGCGCATGAGCAGACCTATGAAGGGTTTATCAAGCTGGTGAAGTACGGCACCGCCGCCGTCATCGTGATCGTCGCTCTCATGGGCATTTTCCTGACT
TRN  11011111101111111
//