EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07529 - HSA)
FAM  PF07529
PID  HSA
DES  HSA
IPR  IPR006562
ANO  14
ALN  73
AID  0.235172
APH  ((Q7YZ94_DROME/508-579:0.31011,Q9LRX3_ARATH/541-607:0.88773):0.00000,(((Q06337_YEAST/347-418:1.64225,O59773_SCHPO/467-539:0.49140):0.93430,EP400_MOUSE/799-870:0.18986):0.00000,(Q7ZSY3_BRARE/478-550:0.04377,((Q19106_CAEEL/272-344:0.11579,Q22944_CAEEL/176-248:1.15527):0.25726,(BRM_DROME/501-573:0.16873,((SNF21_SCHPO/256-328:0.39479,Q7RYI6_NEUCR/344-416:0.52888):0.43172,Q7Z1V5_TETTH/251-323:0.92979):0.24249):0.05579):0.15899):1.88620):0.25112,(Q7X9V2_ARATH/36-107:0.43045,SWR1_YEAST/340-411:1.60747):0.22255);
ATP  ((Q7YZ94_DROME/508-579,Q9LRX3_ARATH/541-607),(((Q06337_YEAST/347-418,O59773_SCHPO/467-539),EP400_MOUSE/799-870),(Q7ZSY3_BRARE/478-550,((Q19106_CAEEL/272-344,Q22944_CAEEL/176-248),(BRM_DROME/501-573,((SNF21_SCHPO/256-328,Q7RYI6_NEUCR/344-416),Q7Z1V5_TETTH/251-323))))),(Q7X9V2_ARATH/36-107,SWR1_YEAST/340-411));
ATL  13.3367
DNO  13
DLN  219
DID  0.375514
DPH  ((((Q06337_YEAST/347-418:0.74156,O59773_SCHPO/467-539:0.43743):0.21503,Q9LRX3_ARATH/541-607:0.37325):0.19051,Q7YZ94_DROME/508-579:0.28543):0.15563,Q7X9V2_ARATH/36-107:0.32093,((((Q7Z1V5_TETTH/251-323:0.89518,((BRM_DROME/501-573:0.22306,Q7ZSY3_BRARE/478-550:0.30214):0.06490,(Q7RYI6_NEUCR/344-416:0.40791,SNF21_SCHPO/256-328:0.41460):0.37182):0.00000):0.14968,Q19106_CAEEL/272-344:0.17369):0.35771,Q22944_CAEEL/176-248:0.38496):0.57238,SWR1_YEAST/340-411:0.68787):0.25118);
DTP  ((((Q06337_YEAST/347-418,O59773_SCHPO/467-539),Q9LRX3_ARATH/541-607),Q7YZ94_DROME/508-579),Q7X9V2_ARATH/36-107,((((Q7Z1V5_TETTH/251-323,((BRM_DROME/501-573,Q7ZSY3_BRARE/478-550),(Q7RYI6_NEUCR/344-416,SNF21_SCHPO/256-328))),Q19106_CAEEL/272-344),Q22944_CAEEL/176-248),SWR1_YEAST/340-411));
DTL  7.87732
RID  0.229841
RPH  (Q9LRX3_ARATH/541-607:0.81503,((((Q7Z1V5_TETTH/251-323:1.00369,(((BRM_DROME/501-573:0.21186,Q7ZSY3_BRARE/478-550:0.20562):0.05710,(Q19106_CAEEL/272-344:0.12325,Q22944_CAEEL/176-248:1.15067):0.20580):0.14624,(SNF21_SCHPO/256-328:0.35330,Q7RYI6_NEUCR/344-416:0.57246):0.49635):0.00000):1.95973,SWR1_YEAST/340-411:1.29720):0.38890,(Q06337_YEAST/347-418:1.58171,O59773_SCHPO/467-539:0.58402):0.74691):0.21427,Q7YZ94_DROME/508-579:0.31981):0.09918,Q7X9V2_ARATH/36-107:0.54345);
RTP  (Q9LRX3_ARATH/541-607,((((Q7Z1V5_TETTH/251-323,(((BRM_DROME/501-573,Q7ZSY3_BRARE/478-550),(Q19106_CAEEL/272-344,Q22944_CAEEL/176-248)),(SNF21_SCHPO/256-328,Q7RYI6_NEUCR/344-416))),SWR1_YEAST/340-411),(Q06337_YEAST/347-418,O59773_SCHPO/467-539)),Q7YZ94_DROME/508-579),Q7X9V2_ARATH/36-107);
RTL  13.0766
LNK  BRM_DROME/501-573:P25439:M85049
LNK  EP400_MOUSE/799-870:Q8CHI8:
LNK  O59773_SCHPO/467-539:O59773:AL022598
LNK  Q06337_YEAST/347-418:Q06337:U28372
LNK  Q19106_CAEEL/272-344:Q19106:Z68751
LNK  Q22944_CAEEL/176-248:Q22944:U64598
LNK  Q7RYI6_NEUCR/344-416:Q7RYI6:AABX01000726
LNK  Q7X9V2_ARATH/36-107:Q7X9V2:AY279398
LNK  Q7YZ94_DROME/508-579:Q7YZ94:AE003453
LNK  Q7Z1V5_TETTH/251-323:Q7Z1V5:AY268943
LNK  Q7ZSY3_BRARE/478-550:Q7ZSY3:AY205256
LNK  Q9LRX3_ARATH/541-607:Q9LRX3:AB028609
LNK  SNF21_SCHPO/256-328:Q9UTN6:AB162438
LNK  SWR1_YEAST/340-411:Q05471:U51032
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9LRX3_ARATH/541-607
ASQ  GTAPVEVREKSQWDFVLEEMAWLANDFAQERLWKMTAAAQICHRVAL------TCQLRFEERNQHRKLKKIAS
DSQ  GGTACTGCACCAGTGGAGGTCCGTGAGAAATCTCAATGGGATTTTGTCCTCGAAGAAATGGCATGGCTGGCAAATGATTTTGCGCAGGAGCGCCTTTGGAAAATGACTGCTGCCGCACAAATTTGCCATCGAGTTGCTTTG------------------ACTTGTCAGTTGAGATTTGAGGAACGAAATCAGCACAGAAAGCTGAAAAAAATAGCTTCA
TRN  10010101100011001
NAM  Q7YZ94_DROME/508-579
ASQ  PKLQEPSRPKAHWDYLLEEMVWLAADFAQERKWKKNAAKKCAKMVQKYFQDKATAAQRA-EKAQELQLKRVAS
DSQ  CCCAAGCTGCAGGAGCCCAGCCGCCCCAAGGCGCATTGGGACTATCTTCTCGAGGAGATGGTCTGGCTGGCGGCAGATTTTGCACAGGAACGCAAGTGGAAGAAAAACGCGGCCAAGAAGTGTGCCAAGATGGTGCAGAAGTATTTCCAGGACAAGGCCACCGCTGCCCAGCGGGCG---GAAAAGGCCCAAGAGCTGCAGCTAAAGCGTGTCGCTTCC
TRN  11011101101011011
NAM  EP400_MOUSE/799-870
ASQ  PKLQEAPRPKSHWDYLLEEMQWMATDFAQERRWKLAAAKKLVRTVARHHEEKKLREERG-KKEEQSRLRRIAA
NAM  Q7X9V2_ARATH/36-107
ASQ  EAPKEPRRPKTHWDHVLEEMAWLSKDFESERKWKLAQAKKVALRASKGMLDQASREERK-LKEEEQRLRKVAL
DSQ  GAAGCTCCTAAAGAACCACGTCGTCCTAAAACTCACTGGGACCATGTATTGGAGGAGATGGCTTGGCTGTCAAAGGACTTTGAGTCTGAGAGGAAATGGAAGCTGGCGCAGGCGAAGAAGGTTGCTTTGAGAGCCAGCAAAGGAATGCTAGATCAGGCATCTAGGGAAGAAAGGAAG---CTAAAGGAAGAAGAACAGCGACTTCGGAAAGTAGCCCTC
TRN  10010101100011001
NAM  O59773_SCHPO/467-539
ASQ  KRQNEMPRLKTHRDYVLDEMQWMSIDFSQERKWKIILAHRMANWVMDYHQASDKCTVCTPASLSKNKKPYMQE
DSQ  AAAAGACAAAACGAGATGCCACGATTGAAAACTCATCGGGATTATGTTTTGGATGAGATGCAATGGATGTCAATTGATTTTTCTCAAGAGCGTAAATGGAAAATTATATTGGCTCATAGAATGGCGAATTGGGTAATGGATTACCATCAAGCTAGTGATAAATGTACTGTTTGTACTCCGGCTTCGTTGTCAAAGAATAAGAAGCCGTACATGCAAGAG
TRN  10010101110011001
NAM  SWR1_YEAST/340-411
ASQ  SYFYKQQDLQIHTDHLINQGIHMSKLFRSSTKARIARAKKVSQMIEQHFKHVAGAEERK-AKEEERHKKSLAR
DSQ  TCATATTTCTATAAACAACAAGATCTGCAAATCCATACCGATCACTTAATTAACCAAGGTATTCATATGAGTAAGCTGTTTAGAAGTTCAACAAAGGCAAGAATAGCAAGAGCCAAAAAGGTTTCTCAAATGATAGAACAACATTTTAAACACGTAGCCGGAGCAGAAGAAAGAAAG---GCAAAGGAGGAGGAGAGGCACAAAAAGTCGCTAGCCAGG
TRN  10010101100011000
NAM  Q06337_YEAST/347-418
ASQ  RFIDPWKQHNTHQNILLEEAKWMQADFKEGHKYKVAICTAMAQAIKDYWTYGEICCVKR-KTLLPGKENKLSD
DSQ  AGATTCATCGATCCGTGGAAACAACACAATACGCATCAAAACATACTTTTAGAAGAAGCTAAATGGATGCAAGCAGATTTTAAAGAGGGCCACAAATATAAAGTAGCTATCTGCACAGCAATGGCACAGGCAATCAAGGACTACTGGACCTATGGGGAAATATGCTGTGTAAAACGT---AAAACACTTCTACCTGGTAAGGAAAATAAATTATCTGAC
TRN  10010101110011010
NAM  Q22944_CAEEL/176-248
ASQ  DRAILEKRRKVTNFHFLQSLTKHAREFKEFHKRNMLNHTKVRKSMQQYITNENKRIAREEMKNEKNRIQKLIQ
DSQ  GATCGAGCCATCTTGGAAAAAAGACGAAAGGTCACAAATTTTCATTTTCTGCAAAGTCTTACCAAGCACGCGCGGGAGTTTAAAGAGTTTCATAAACGAAATATGTTGAATCACACAAAGGTTCGAAAATCCATGCAACAATACATCACCAACGAAAACAAGAGAATTGCCCGCGAGGAGATGAAGAACGAGAAAAACCGAATTCAAAAGTTGATCCAG
TRN  10010101100011011
NAM  Q19106_CAEEL/272-344
ASQ  QKMEQERKRRQKHTDLMQAIIQHGKEFKEYHRNNLLKMAKSRKAVMTYHQNNERERKKDEIRNEKLRMQKLMQ
DSQ  CAAAAGATGGAGCAAGAAAGAAAGAGAAGGCAGAAGCATACTGATTTGATGCAAGCTATCATTCAGCATGGAAAGGAATTCAAGGAGTATCATAGAAACAATCTTCTGAAAATGGCAAAGTCTCGCAAGGCAGTCATGACATATCATCAAAACAATGAACGTGAACGCAAGAAGGACGAGATTCGAAATGAAAAACTTCGTATGCAAAAACTGATGCAA
TRN  10010101100011011
NAM  Q7ZSY3_BRARE/478-550
ASQ  QKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSITAKMQKLTKAVATYHANTEREQKKENERIEKERMRRLMA
DSQ  CAGAAGATCGAGCAGGAACGCAAACGCAGACAGAAACACCAGGAGTATCTCAACAGTATCCTGCAGCATGCAAAGGACTTCAAGGAATATCATCGTTCCATCACCGCAAAGATGCAGAAGTTGACCAAAGCCGTAGCCACGTACCACGCCAACACTGAGCGAGAGCAGAAGAAGGAGAATGAGCGTATCGAGAAGGAGAGAATGAGAAGGCTTATGGCT
TRN  10010101100011011
NAM  BRM_DROME/501-573
ASQ  QKLEAERKRRQKHLEFLAAVLQHGKDLREFHRNNKAQLARMNKAVMNHHANAEREQKKEQERIEKERMRRLMA
DSQ  CAGAAGCTAGAGGCTGAACGAAAGCGTCGCCAAAAGCATCTGGAGTTCTTGGCTGCTGTGCTTCAGCACGGCAAGGATCTAAGGGAGTTCCACAGAAATAATAAGGCCCAGCTTGCAAGGATGAACAAGGCCGTGATGAATCACCACGCCAATGCCGAGCGTGAACAGAAGAAGGAACAAGAGCGCATCGAAAAGGAACGTATGCGACGTCTGATGGCC
TRN  10010101100011011
NAM  Q7Z1V5_TETTH/251-323
ASQ  FKQEQEKRKKQKHREFLQQIFIHQNDFFEFHKKIKKQLKKRSNAARQYLEQLQIKQQMQKEKEAKERIQVLKS
DSQ  TTCAAGCAAGAATAAGAGAAGAGAAAGAAATAAAAGCATAGAGAATTCCTCTAGTAGATTTTCATTCACCAAAATGATTTCTTCGAATTCCACAAGAAAATCAAGAAATAGTTGAAGAAGCGCTCAAATGCTGCCAGACAATATCTCGAATAGCTCCAAATCAAGTAACAAATGCAAAAAGAAAAGGAAGCTAAAGAACGTATTCAAGTTCTTAAATCA
TRN  00000100000000000
NAM  SNF21_SCHPO/256-328
ASQ  QRSDRERRLKQKQCDYLQTVCAHGREINVRTKNAQARAQKANRAVLAYHSHIEKEEQRRAERNAKQRLQALKE
DSQ  CAAAGAAGTGATCGCGAAAGAAGGTTAAAGCAAAAACAGTGCGATTATCTGCAAACTGTATGTGCCCATGGTCGAGAGATTAATGTCCGAACCAAGAATGCTCAGGCAAGGGCTCAGAAAGCGAATCGCGCTGTATTGGCGTATCATTCGCATATCGAAAAAGAAGAACAGCGTCGTGCTGAACGCAATGCAAAGCAAAGATTACAAGCCTTGAAGGAG
TRN  10010101100011010
NAM  Q7RYI6_NEUCR/344-416
ASQ  QRDARENRERKKHVEFLQAVQNHKVEIQNVASIQRNKLQKMGRLMYAHHFNIEKEEQKRVERTAKQRLQALKA
DSQ  CAACGTGACGCGCGCGAGAATAGAGAACGCAAGAAGCACGTCGAGTTTCTGCAAGCGGTTCAAAACCACAAGGTGGAGATACAAAACGTCGCCTCAATTCAGCGTAACAAGCTACAGAAGATGGGTCGTCTCATGTATGCGCATCACTTCAACATCGAGAAAGAGGAGCAAAAGAGGGTGGAAAGGACGGCCAAGCAGCGTCTGCAGGCCCTCAAGGCC
TRN  10010101100011001
//