EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07421 - Pro-NT_NN)
FAM  PF07421
PID  Pro-NT_NN
DES  Neurotensin/neuromedin N precursor
IPR  IPR008055
ANO  3
ALN  169
AID  0.836937
APH  (NEUT_MOUSE/1-169:0.02583,NEUT_RAT/1-169:0.08219,NEUT_BOVIN/1-169:0.17725);
ATP  (NEUT_MOUSE/1-169,NEUT_RAT/1-169,NEUT_BOVIN/1-169);
ATL  0.28527
DNO  2
DLN  507
DID  0.828402
DPH  (NEUT_MOUSE/1-169:0.14617,NEUT_BOVIN/1-169:0.05300);
DTP  (NEUT_MOUSE/1-169,NEUT_BOVIN/1-169);
DTL  0.19917
RID  0.823899
RPH  (NEUT_MOUSE/1-169:0.11613,NEUT_BOVIN/1-169:0.08310);
RTP  (NEUT_MOUSE/1-169,NEUT_BOVIN/1-169);
RTL  0.19923
LNK  NEUT_BOVIN/1-169:P01156:M18621
LNK  NEUT_MOUSE/1-169:Q9D3P9:AF348489
LNK  NEUT_RAT/1-169:P20068:
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  NEUT_MOUSE/1-169
ASQ  MRGMNLQLVCLTLLAFSSWSLCSDSEEDVRALEADLLTNMHTSKISKASPPSWKMTLLNVCSLINNVNSPAEEAGDMHDDDLVGKRKLPLVLDGFSLEAMLTIFQLQKICRSRAFQHWEIIQEDILDNVNDKNEKEEVIKRKIPYILKRQLYENKPRRPYILKRGSYYY
DSQ  ATGAGAGGAATGAATCTCCAGCTGGTGTGCCTGACTCTCCTGGCTTTCAGCTCCTGGAGTCTGTGCTCAGATTCAGAAGAAGATGTGAGAGCCCTGGAGGCAGATCTATTGACAAACATGCATACATCCAAGATCAGCAAAGCAAGTCCTCCGTCTTGGAAAATGACCTTGCTAAATGTTTGCAGCCTCATAAATAACGTGAACAGCCCGGCCGAGGAAGCAGGAGACATGCATGATGACGACCTTGTTGGCAAAAGGAAACTTCCCCTTGTTCTGGATGGTTTTAGCTTGGAAGCAATGCTGACCATCTTCCAGCTCCAGAAAATCTGCCGCAGCAGGGCCTTTCAACACTGGGAGATAATCCAGGAAGATATCCTTGATAACGTCAATGATAAAAACGAGAAGGAAGAAGTGATAAAGAGAAAAATCCCTTATATTCTGAAAAGGCAGCTGTATGAAAATAAACCCAGAAGGCCCTACATTCTCAAGAGGGGTTCCTACTACTAC
TRN  10010101100011001
NAM  NEUT_RAT/1-169
ASQ  MIGMNLQLVCLTLLAFSSWSLCSDSEEDVRALEADLLTNMHASKVSKGSPPSWKMTLLNVCSLINNLNSAAEEAGEMRDDDLVAKRKLPLVLDDFSLEALLTVFQLQKICRSRAFQHWEIIQEDILDHGNEKTEKEEVIKRKIPYILKRQLYENKPRRPYILKRASYYY
NAM  NEUT_BOVIN/1-169
ASQ  MAGMKIQLVCMILLAFSSWSLCSDSEEEMKALETDLLTNMHTSKISKASVPSWKMSLLNVCSLINNLNSQAEETGEFHEEELITRRKFPAALDGFSLEAMLTIYQLQKICHSRAFQHWELIQEDILDAGNDKNEKEEVIKRKIPYILKRQLYENKPRRPYILKRGSYYY
DSQ  ATGGCAGGAATGAAAATCCAGCTGGTGTGCATGATTCTTCTGGCTTTCAGCTCCTGGAGTCTGTGCTCAGATTCAGAAGAGGAAATGAAAGCGTTAGAAACAGATTTACTGACCAATATGCATACATCAAAGATCAGTAAGGCAAGTGTTCCCTCTTGGAAAATGAGCCTGCTGAATGTCTGCAGTCTTATAAATAACCTGAACAGCCAAGCTGAGGAAACAGGAGAGTTTCATGAGGAGGAGCTCATTACAAGAAGGAAATTTCCTGCTGCCTTAGATGGTTTTAGCTTGGAAGCAATGTTGACGATATACCAGCTCCAAAAAATCTGTCACAGCAGGGCCTTTCAACACTGGGAGTTGATTCAGGAAGACATTCTTGATGCTGGAAATGACAAAAATGAAAAGGAAGAAGTGATAAAGAGAAAAATTCCTTACATTCTGAAACGGCAGCTTTATGAGAATAAACCCAGAAGACCCTACATACTCAAAAGAGGTTCTTACTACTAC
TRN  10010101100011000
//