EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07240 - Turandot)
FAM  PF07240
PID  Turandot
DES  Stress-inducible humoral factor Turandot
IPR  IPR010825
ANO  6
ALN  136
AID  0.307468
APH  ((Q9VMR8_DROME/1-130:0.61816,(Q8INV7_DROME/1-119:0.24302,Q962D8_DROME/1-125:0.50341):0.28330):0.19514,Q8IN42_DROME/1-112:0.80011,(Q8IN41_DROME/1-128:0.95114,Q9VDH4_DROME/1-117:0.78925):0.45145);
ATP  ((Q9VMR8_DROME/1-130,(Q8INV7_DROME/1-119,Q962D8_DROME/1-125)),Q8IN42_DROME/1-112,(Q8IN41_DROME/1-128,Q9VDH4_DROME/1-117));
ATL  4.88408
DNO  6
DLN  408
DID  0.422409
DPH  ((Q9VMR8_DROME/1-130:0.41185,(Q8INV7_DROME/1-119:0.24082,Q962D8_DROME/1-125:0.33712):0.21960):0.13550,Q8IN42_DROME/1-112:0.54077,(Q8IN41_DROME/1-128:0.61059,Q9VDH4_DROME/1-117:0.61557):0.30872);
DTP  ((Q9VMR8_DROME/1-130,(Q8INV7_DROME/1-119,Q962D8_DROME/1-125)),Q8IN42_DROME/1-112,(Q8IN41_DROME/1-128,Q9VDH4_DROME/1-117));
DTL  3.42054
RID  0.307468
RPH  ((Q9VMR8_DROME/1-130:0.61816,(Q8INV7_DROME/1-119:0.24302,Q962D8_DROME/1-125:0.50341):0.28330):0.19514,Q8IN42_DROME/1-112:0.80011,(Q8IN41_DROME/1-128:0.95114,Q9VDH4_DROME/1-117:0.78925):0.45145);
RTP  ((Q9VMR8_DROME/1-130,(Q8INV7_DROME/1-119,Q962D8_DROME/1-125)),Q8IN42_DROME/1-112,(Q8IN41_DROME/1-128,Q9VDH4_DROME/1-117));
RTL  4.88408
LNK  Q8IN41_DROME/1-128:Q8IN41:AE003732
LNK  Q8IN42_DROME/1-112:Q8IN42:AE003732
LNK  Q8INV7_DROME/1-119:Q8INV7:AE003664
LNK  Q962D8_DROME/1-125:Q962D8:AY035991
LNK  Q9VDH4_DROME/1-117:Q9VDH4:AE003732
LNK  Q9VMR8_DROME/1-130:Q9VMR8:AE003609
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q962D8_DROME/1-125
ASQ  MKTVILFGFLLALLGYLE-AEHAQSDPEFTAKARQM--LAVFGNSEVDRYTKTRKLPALIEFYEKYS----SRLPLTVQDRTYANNVVRRYRAHNNQ--QVDGVPAQGG--VGVVFALLLPFAVSIVEGIAKAIRE
DSQ  ATGAAGACAGTCATTCTATTTGGCTTTCTGCTGGCACTTCTTGGATATTTGGAA---GCAGAACATGCACAGAGTGATCCTGAATTCACGGCCAAGGCACGTCAAATG------CTCGCAGTCTTCGGCAACTCAGAGGTCGATAGATACACCAAGACCCGAAAATTGCCCGCATTGATTGAGTTCTACGAGAAGTACTCC------------AGTCGTCTGCCACTAACTGTCCAGGATCGGACCTATGCCAACAATGTGGTCAGAAGGTACCGGGCACACAACAACCAA------CAGGTCGATGGTGTTCCTGCTCAGGGCGGA------GTTGGTGTGGTGTTCGCGCTACTTCTTCCTTTCGCTGTGTCAATTGTGGAAGGAATCGCCAAGGCGATCAGAGAA
TRN  10010101100011001
NAM  Q8INV7_DROME/1-119
ASQ  MNSALQISCLLVVLGCLLGSGHCQSEAEFAAKSREI--AQVFGNPSVDKYTKARNLPTLIAFYEKYS----SRLRLTPQERISINNAMRQYKAQRNQ--QVDGVSAQGGWLSDI---------IKTAISIIVKAVE
DSQ  ATGAATTCCGCACTGCAAATCAGCTGCCTTCTCGTTGTTCTTGGCTGCCTTTTGGGTTCAGGACACTGCCAAAGTGAAGCTGAATTCGCGGCCAAGTCCCGAGAAATA------GCCCAAGTATTCGGCAATCCCTCCGTCGATAAATACACGAAGGCTCGCAATTTGCCCACGCTGATTGCCTTCTACGAGAAATACTCC------------AGTCGCCTACGATTGACACCTCAGGAAAGGATTAGTATCAATAATGCTATGAGGCAATATAAGGCACAACGAAACCAG------CAAGTTGACGGAGTATCTGCCCAGGGAGGATGGTTGTCTGACATT---------------------------ATCAAGACAGCAATTTCGATCATTGTAAAGGCCGTTGAA
TRN  10010101100011001
NAM  Q9VMR8_DROME/1-130
ASQ  MNPTIYLSCLMVFSVFLLGKVNAENEDEFVTEKQRL--FSVYGDSSVDEATKYRNIDSLVTFYDKYF----TRLQLKPDLNTRAHDLLRRYKEENARVVLVDGTPAQGGFWLPLVKLLIVQLGVEIASEGVKRAIE
DSQ  ATGAATCCTACAATTTATTTGAGCTGCCTTATGGTCTTCTCAGTGTTTCTGCTGGGAAAGGTAAATGCTGAGAACGAAGATGAGTTCGTCACAGAAAAACAGCGCCTA------TTTAGTGTGTATGGTGATTCTTCGGTTGATGAGGCCACCAAATACCGGAACATCGACAGCCTGGTCACTTTCTACGATAAGTACTTC------------ACTCGACTTCAGTTGAAACCGGACTTGAACACACGCGCCCATGATCTCTTGAGGCGTTACAAGGAGGAAAATGCTCGTGTGGTCTTGGTGGACGGTACTCCCGCACAAGGCGGATTCTGGTTGCCACTGGTGAAGCTACTCATTGTCCAGCTGGGCGTCGAAATTGCCTCTGAGGGAGTCAAGCGTGCTATTGAA
TRN  10010101100011001
NAM  Q8IN42_DROME/1-112
ASQ  MYFAIRLSFVLAVLICLTGNGSARMLD---ADRNRLQQLQIRSQQSADANTQVDIAYEVIGIYDKYKGQGGSNVLREAQLNSQVNDF----KRKTMV---IDGVPAQGGVWGIL--------------GAIKKAAD
DSQ  ATGTATTTTGCCATCCGACTAAGCTTTGTTCTGGCAGTGCTCATCTGTCTCACAGGAAACGGAAGTGCTAGAATGCTGGAT---------GCAGATCGCAACCGGCTCCAGCAACTTCAGATTCGAAGTCAGCAATCTGCGGATGCCAACACCCAGGTGGATATTGCTTATGAAGTCATCGGAATTTATGATAAATACAAGGGCCAGGGGGGATCGAATGTGTTGAGAGAGGCTCAATTGAATTCACAAGTTAATGATTTT------------AAAAGAAAGACTATGGTC---------ATCGATGGAGTGCCAGCCCAAGGAGGAGTTTGGGGTATTTTA------------------------------------------GGAGCAATAAAGAAGGCCGCTGAT
TRN  10010101100011000
NAM  Q9VDH4_DROME/1-117
ASQ  M--NFKTSLICFALLLIGTLCSAYSNQERQRDSRRV--AEIMRTSW-DDNTKIKRIQELLTIYNRMA----PSLR--PDERARMDRFISGYTGE--I--MVDGVPSQGG-ARRIFKKILSPAAKSVATGFFT---E
DSQ  ATG------AATTTTAAAACGTCTTTGATCTGTTTCGCACTGCTACTGATTGGAACTCTATGCTCGGCCTATTCCAATCAAGAACGTCAACGTGACAGTCGTAGGGTT------GCTGAAATTATGCGAACCTCCTGG---GACGACAATACCAAAATCAAAAGAATCCAGGAACTACTTACCATATACAATCGCATGGCT------------CCTAGCTTAAGA------CCAGATGAAAGGGCGAGAATGGACAGATTCATAAGTGGATATACGGGAGAA------ATC------ATGGTCGATGGAGTACCCAGTCAAGGTGGT---GCTAGAAGGATCTTTAAGAAGATTCTGTCTCCGGCGGCAAAGAGCGTGGCAACTGGATTCTTTACC---------GAA
TRN  10010101100011010
NAM  Q8IN41_DROME/1-128
ASQ  MGLSIGSLLICVFLGIVPFATANTNSSSYEEHRNYL--LNIFHNPFVNDSIKEKNIPQLIAFYQRYP----TDVPLSDADRQQFERFIHDYREYRAV--LVDGAPPQGGSFGNIFGHFLGRVGTRYISSLFNKKRE
DSQ  ATGGGGCTTTCTATTGGCAGCTTGCTAATATGCGTGTTCTTAGGCATAGTTCCTTTTGCAACTGCTAACACAAACAGTTCAAGTTATGAGGAACACAGGAATTATTTG------CTTAACATCTTTCACAATCCATTTGTGAATGACTCCATTAAGGAGAAAAATATTCCGCAGCTAATCGCTTTTTATCAACGATATCCT------------ACAGATGTTCCTCTATCCGACGCAGACAGGCAACAATTTGAAAGGTTTATTCATGATTACAGAGAATACCGGGCAGTT------TTGGTTGATGGTGCACCACCTCAAGGAGGATCATTTGGAAACATATTTGGACACTTCCTAGGCAGAGTCGGAACCCGGTATATTTCGTCTCTGTTTAATAAGAAAAGGGAG
TRN  10010101100011000
//