EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07176 - DUF1400)
FAM  PF07176
PID  DUF1400
DES  Protein of unknown function (DUF1400)
IPR  IPR010802
ANO  10
ALN  135
AID  0.313895
APH  ((((Q8YVC8_ANASP/32-157:0.66864,Q8DKB8_SYNEL/26-151:0.57822):0.22825,(Q8DI73_SYNEL/34-160:0.54522,(Q8YY82_ANASP/24-151:0.50446,Q8DJF1_SYNEL/29-156:0.54570):0.17516):0.12912):0.16285,(P72989_SYNY3/33-158:0.34454,Q8YQI8_ANASP/27-152:0.44018):0.44480):0.10845,Q8RSV9_SYNP2/31-153:0.94165,(P73946_SYNY3/76-204:0.72756,P74506_SYNY3/27-153:0.74975):0.11852);
ATP  ((((Q8YVC8_ANASP/32-157,Q8DKB8_SYNEL/26-151),(Q8DI73_SYNEL/34-160,(Q8YY82_ANASP/24-151,Q8DJF1_SYNEL/29-156))),(P72989_SYNY3/33-158,Q8YQI8_ANASP/27-152)),Q8RSV9_SYNP2/31-153,(P73946_SYNY3/76-204,P74506_SYNY3/27-153));
ATL  7.41307
DNO  10
DLN  405
DID  0.426342
DPH  (((((Q8YY82_ANASP/24-151:0.47655,P74506_SYNY3/27-153:0.49025):0.13074,(Q8DJF1_SYNEL/29-156:0.55528,Q8DI73_SYNEL/34-160:0.40725):0.07521):0.10608,(Q8RSV9_SYNP2/31-153:0.60991,P73946_SYNY3/76-204:0.46686):0.06895):0.05991,(Q8YQI8_ANASP/27-152:0.38183,P72989_SYNY3/33-158:0.39272):0.22222):0.15749,Q8YVC8_ANASP/32-157:0.55696,Q8DKB8_SYNEL/26-151:0.41973);
DTP  (((((Q8YY82_ANASP/24-151,P74506_SYNY3/27-153),(Q8DJF1_SYNEL/29-156,Q8DI73_SYNEL/34-160)),(Q8RSV9_SYNP2/31-153,P73946_SYNY3/76-204)),(Q8YQI8_ANASP/27-152,P72989_SYNY3/33-158)),Q8YVC8_ANASP/32-157,Q8DKB8_SYNEL/26-151);
DTL  5.57794
RID  0.313895
RPH  ((((Q8YVC8_ANASP/32-157:0.66864,Q8DKB8_SYNEL/26-151:0.57822):0.22825,(Q8DI73_SYNEL/34-160:0.54522,(Q8YY82_ANASP/24-151:0.50446,Q8DJF1_SYNEL/29-156:0.54570):0.17516):0.12912):0.16285,(P72989_SYNY3/33-158:0.34454,Q8YQI8_ANASP/27-152:0.44018):0.44480):0.10845,Q8RSV9_SYNP2/31-153:0.94165,(P73946_SYNY3/76-204:0.72756,P74506_SYNY3/27-153:0.74975):0.11852);
RTP  ((((Q8YVC8_ANASP/32-157,Q8DKB8_SYNEL/26-151),(Q8DI73_SYNEL/34-160,(Q8YY82_ANASP/24-151,Q8DJF1_SYNEL/29-156))),(P72989_SYNY3/33-158,Q8YQI8_ANASP/27-152)),Q8RSV9_SYNP2/31-153,(P73946_SYNY3/76-204,P74506_SYNY3/27-153));
RTL  7.41307
LNK  P72989_SYNY3/33-158:P72989:BA000022
LNK  P73946_SYNY3/76-204:P73946:BA000022
LNK  P74506_SYNY3/27-153:P74506:BA000022
LNK  Q8DI73_SYNEL/34-160:Q8DI73:BA000039
LNK  Q8DJF1_SYNEL/29-156:Q8DJF1:BA000039
LNK  Q8DKB8_SYNEL/26-151:Q8DKB8:BA000039
LNK  Q8RSV9_SYNP2/31-153:Q8RSV9:AY075046
LNK  Q8YQI8_ANASP/27-152:Q8YQI8:BA000019
LNK  Q8YVC8_ANASP/32-157:Q8YVC8:BA000019
LNK  Q8YY82_ANASP/24-151:Q8YY82:BA000019
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q8DKB8_SYNEL/26-151
ASQ  AANFVSLTYGPFQR-SFPLSELEEFVSTKEATGQLRGLMRLV--SKDDQAKLLEFLGMRLPFNVVQTDQIL----ASPIGKDLLKQFSQVT-IRRDQAGEVALRGAMITAAASPE-GLSMMSFLKNYPGETINLD
DSQ  GCAGCTAACTTTGTCTCCCTCACCTATGGTCCTTTTCAGCGC---TCCTTCCCCCTGTCGGAGCTAGAAGAATTTGTGTCCACCAAAGAAGCCACGGGACAATTGCGAGGATTGATGCGACTGGTT------TCCAAAGACGACCAAGCTAAGCTTCTTGAATTTTTGGGTATGCGGTTGCCCTTTAACGTTGTACAAACCGATCAAATTCTT------------GCCAGCCCCATTGGTAAAGATTTGCTCAAACAATTTTCTCAGGTGACA---ATTCGCCGTGATCAAGCTGGGGAAGTTGCCCTTCGCGGTGCCATGATCACTGCCGCTGCCTCCCCAGAA---GGCTTGAGTATGATGTCGTTTTTGAAAAACTATCCTGGTGAAACCATTAACTTGGAT
TRN  11011101101011011
NAM  Q8DJF1_SYNEL/29-156
ASQ  AAEEISLIYPPFGTFNIQVSDLATFAKTGHTSPELRFLIQLL--PSDQGPNLRESLTTRMNLEPTTVSQFV----KSPIGQSFLERIGQVIRADNDVNGGQALGEALTTAASSPS-GITLLSVLQAFPGKSVRVN
DSQ  GCTGCCGAGGAAATTAGCCTTATTTATCCCCCCTTCGGCACCTTCAACATTCAAGTCAGTGACCTTGCCACATTTGCCAAAACAGGTCATACCAGTCCAGAGCTAAGGTTTTTAATTCAATTGCTC------CCAAGTGATCAAGGGCCCAACCTGCGGGAGAGCCTCACAACCCGCATGAACTTAGAACCCACCACCGTCAGCCAGTTTGTC------------AAAAGTCCCATTGGTCAAAGCTTTTTAGAGCGTATCGGCCAAGTTATTCGTGCAGATAATGATGTCAATGGTGGCCAAGCCCTTGGTGAAGCCCTGACAACCGCCGCCAGCTCTCCCTCA---GGAATTACCCTCCTCTCAGTCCTACAGGCCTTTCCCGGCAAGAGTGTTAGAGTCAAT
TRN  10010101100011000
NAM  Q8YY82_ANASP/24-151
ASQ  SAERISLFYPPFGEFSLPVSSLETFAKEGKIDSDLQFYAQRA--TPAQLAQLREFLQQRFDVTPTFISQIT----YSPIGEQVLQRLGDIVQTDSRRNGFYALRSALILSAAKPQ-GFSVINVLRNFPSDNLRLN
DSQ  AGCGCTGAACGTATCAGTCTTTTTTACCCTCCTTTTGGTGAATTTTCTTTACCTGTTAGTTCGCTAGAAACCTTTGCTAAGGAAGGGAAGATTGATAGTGATTTACAGTTTTATGCTCAACGTGCA------ACTCCCGCACAGTTGGCGCAACTACGAGAATTTCTACAACAACGTTTTGATGTAACTCCTACCTTCATATCTCAAATTACT------------TACTCACCCATCGGTGAACAGGTTTTGCAACGCCTGGGAGACATAGTACAAACTGATTCCCGCCGCAATGGCTTTTATGCTTTGCGTTCTGCATTGATTCTATCCGCAGCTAAACCACAG---GGTTTCTCAGTTATTAATGTTTTACGTAATTTTCCTAGTGATAATTTGCGGCTGAAT
TRN  10010101100011000
NAM  Q8DI73_SYNEL/34-160
ASQ  AAEQIIFRYGPFER-SLPIADLEWFATTGQSSPKLASYLRLF--PPGHRQQLRLALQERLRLSPVAVAQLL----YSPLGQEFMVQAGRILQTQSRQENALALRAALILAATDPN-GLTVLSVMRHYPSPSIRFD
DSQ  GCAGCAGAGCAAATTATTTTTCGCTATGGCCCCTTCGAGCGA---TCGCTCCCCATTGCTGATTTAGAATGGTTTGCTACCACTGGCCAGAGCTCGCCAAAACTTGCGAGCTATTTACGGCTATTC------CCCCCTGGGCACCGGCAGCAATTGCGATTGGCCTTACAAGAACGACTGCGATTGTCCCCCGTGGCCGTTGCTCAACTGTTG------------TACTCCCCCCTGGGTCAAGAATTTATGGTGCAAGCGGGGCGGATTCTCCAAACCCAAAGCCGTCAAGAAAATGCCCTTGCGCTGCGGGCGGCGCTGATTCTCGCTGCCACTGACCCCAAT---GGTCTCACCGTGTTGAGTGTGATGCGCCACTACCCCTCCCCCAGTATTCGCTTTGAC
TRN  11011101101011010
NAM  Q8YQI8_ANASP/27-152
ASQ  AAERVVLKYKVFRE-TIVVEELSTFAQTGALSSSLRINLAL---ARQNPKVIRQYLTTPIKVSPVLLDRVL----NSPVGNIILDELSQVIHTPSRSADRQALRSALVLSASGDG-QVTLIEIIQNYPTPNVEID
DSQ  GCTGCTGAAAGAGTAGTACTGAAGTACAAGGTCTTCCGTGAA---ACTATTGTTGTAGAAGAATTGTCAACCTTTGCTCAAACTGGCGCACTCTCAAGTTCACTACGAATTAATTTAGCTTTG---------GCTCGACAAAACCCTAAAGTAATTCGTCAATATTTAACAACACCAATCAAAGTCAGCCCTGTACTTTTAGATCGGGTTTTA------------AACAGTCCTGTTGGTAACATTATTCTTGATGAGCTAAGTCAAGTTATCCACACACCATCCCGCAGTGCTGATAGACAAGCTTTGCGTTCCGCTTTGGTACTTTCCGCTAGTGGTGATGGA---CAAGTGACTTTAATAGAAATCATCCAAAATTATCCTACTCCAAACGTAGAAATTGAC
TRN  10010101100011000
NAM  P72989_SYNY3/33-158
ASQ  AAERVVLTYSVLRE-SISIEELGELSRTGKVSPSLKAYLKM---ANKNPEELRGWLNRPFQADPVTLSRVL----NSFAGEYVLNQVGQVIHTPSKRDNKEALRGAIISSAEKDN-QVRLIEVLENYPTPELHVN
DSQ  GCAGCGGAACGGGTGGTGCTGACCTATAGTGTTTTGCGAGAA---TCCATCTCCATTGAGGAGTTAGGGGAGTTGAGCCGCACTGGGAAAGTGTCCCCCTCCCTCAAAGCCTATTTAAAAATG---------GCCAATAAAAACCCTGAAGAATTGCGGGGTTGGCTCAATCGACCGTTTCAGGCAGATCCAGTTACCCTCTCCCGGGTGCTC------------AACAGTTTTGCCGGGGAATATGTGCTCAATCAGGTGGGTCAGGTAATCCACACCCCTTCTAAGCGGGACAATAAAGAAGCTCTGCGGGGAGCTATTATCAGCTCTGCAGAAAAAGACAAT---CAGGTACGACTGATCGAAGTGTTGGAAAATTATCCCACCCCAGAACTCCACGTCAAC
TRN  11011101101011010
NAM  Q8YVC8_ANASP/32-157
ASQ  AAETVVVRFGLFAE-SIPVADLQKAAETGEFPSSLNLFTRRL--SEQQRRTIIGALRMRVPLNVVTISRLL----NTQIGTTILNDLSTAV-VRKDQSGAKALRASLVLGSTAPQ-GLSILSFIAAYPSQSLEIN
DSQ  GCAGCTGAGACAGTCGTAGTGAGATTTGGGTTATTTGCCGAA---TCTATTCCTGTGGCTGACTTACAGAAAGCGGCGGAGACTGGCGAATTTCCTAGCAGTTTAAACCTATTCACAAGACGATTA------TCAGAACAACAGCGCCGCACTATCATTGGAGCGCTGAGGATGAGAGTACCGTTGAATGTGGTAACCATCAGTAGGTTACTA------------AATACTCAAATTGGGACAACTATTCTCAATGACTTATCCACGGCCGTA---GTTCGCAAAGATCAATCTGGTGCAAAAGCTTTAAGAGCTAGTTTGGTGTTGGGTTCTACTGCACCACAG---GGTCTTTCTATTCTCAGCTTTATTGCTGCTTACCCCAGTCAGAGCCTAGAAATTAAC
TRN  10010101100011000
NAM  Q8RSV9_SYNP2/31-153
ASQ  AAETLRLKLGPLQQ-TLQLEDLETFAETGQVPRNFRPYGVFL---DGNLQK---FLQRRLQIEPEMADQFFDQLWRSPTGKQILAQIQTAL--PGTSIQDL---QATVDLALGQGVEISALNLLQAYPKQELTID
DSQ  GCCGCTGAAACCCTCCGATTAAAATTAGGGCCACTTCAACAA---ACTTTACAATTAGAAGATTTAGAAACCTTTGCCGAAACGGGTCAAGTCCCCCGCAACTTCCGACCCTATGGGGTATTTTTG---------GATGGTAATTTGCAGAAA---------TTTCTCCAACGACGCTTGCAGATCGAGCCAGAGATGGCGGATCAGTTTTTTGATCAGTTGTGGCGATCGCCTACGGGAAAACAGATTTTGGCGCAAATTCAAACGGCCCTA------CCGGGAACTTCTATTCAGGATCTC---------CAGGCGACGGTGGATTTGGCGTTAGGTCAGGGAGTAGAAATCAGCGCCCTGAATTTGTTGCAGGCTTACCCCAAGCAGGAACTGACTATTGAT
TRN  11011101101011010
NAM  P74506_SYNY3/27-153
ASQ  GAETITFSIMPLGQFDISVKSLTDFAETGTIDPDFKFYTQHL--KPEELEKLRGLLNHSFKFNSVEAFRFF----NTTFGKEIAQQLSYIIAAPTDQSQPF-LEGAIVTAAQNPD-GFKIIDVINAYGGSDLVLN
DSQ  GGGGCCGAAACCATTACTTTTTCCATTATGCCCCTGGGACAGTTTGACATTTCTGTGAAAAGTCTGACAGATTTTGCTGAAACTGGTACCATCGACCCGGATTTTAAATTTTATACTCAGCATCTC------AAGCCAGAAGAACTAGAGAAACTAAGGGGCTTGCTGAACCATTCTTTTAAGTTTAACTCCGTAGAAGCTTTTCGATTTTTT------------AATACAACTTTTGGCAAAGAAATTGCCCAACAATTGAGCTACATTATTGCGGCCCCGACCGATCAAAGCCAACCTTTT---TTAGAAGGGGCGATTGTGACAGCGGCCCAAAACCCTGAC---GGCTTTAAAATTATCGATGTTATTAATGCCTATGGTGGCTCAGATTTAGTTTTAAAC
TRN  10010101100011000
NAM  P73946_SYNY3/76-204
ASQ  TAENIFFTYGPIKL-TVRVESLERFVQDGTVDSNLSFLFNLVGASEEKLAKLREIMGLRAEVDPVVLSNFF----NTSLGEDSLARAAVILNAPWGANSKYGIRAAIVQAAEDPEGGLSLINFIKKYPT-DIHFQ
DSQ  ACTGCGGAAAATATCTTTTTCACCTACGGGCCAATCAAGTTG---ACGGTGCGGGTGGAATCCCTAGAAAGATTTGTGCAGGATGGCACTGTGGATTCCAATCTCAGCTTTTTATTTAATCTGGTGGGAGCTTCCGAAGAAAAATTAGCAAAATTAAGGGAAATTATGGGGCTCCGGGCAGAGGTGGACCCCGTTGTGCTGAGTAACTTTTTT------------AACACCAGCCTGGGGGAAGATTCCCTGGCTAGGGCAGCGGTGATTCTCAATGCCCCCTGGGGAGCTAACTCCAAATATGGTATTCGGGCCGCAATTGTGCAGGCAGCCGAGGATCCAGAAGGGGGACTAAGCCTCATCAATTTCATCAAAAAGTATCCCACC---GATATCCATTTCCAA
TRN  10010101100011010
//