EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07130 - YebG)
FAM  PF07130
PID  YebG
DES  YebG protein
IPR  IPR009813
ANO  6
ALN  75
AID  0.459977
APH  ((((Q8EDY6_SHEON/1-75:0.35118,Q87M79_VIBPA/1-75:0.48082):0.20226,Q8ZFD7_YERPE/1-75:0.15573):0.07077,YEBG_ECOLI/1-75:0.24754):0.81494,Q88E52_PSEPK/1-73:0.22867,Q887T9_PSESM/1-73:0.30928);
ATP  ((((Q8EDY6_SHEON/1-75,Q87M79_VIBPA/1-75),Q8ZFD7_YERPE/1-75),YEBG_ECOLI/1-75),Q88E52_PSEPK/1-73,Q887T9_PSESM/1-73);
ATL  2.88397
DNO  6
DLN  225
DID  0.51517
DPH  (((YEBG_ECOLI/1-75:0.26157,Q87M79_VIBPA/1-75:0.39887):0.07331,(Q887T9_PSESM/1-73:0.26521,Q88E52_PSEPK/1-73:0.18470):0.51014):0.08980,Q8EDY6_SHEON/1-75:0.34637,Q8ZFD7_YERPE/1-75:0.22144);
DTP  (((YEBG_ECOLI/1-75,Q87M79_VIBPA/1-75),(Q887T9_PSESM/1-73,Q88E52_PSEPK/1-73)),Q8EDY6_SHEON/1-75,Q8ZFD7_YERPE/1-75);
DTL  2.35141
RID  0.459977
RPH  ((((Q8EDY6_SHEON/1-75:0.35118,Q87M79_VIBPA/1-75:0.48082):0.20226,Q8ZFD7_YERPE/1-75:0.15573):0.07077,YEBG_ECOLI/1-75:0.24754):0.81494,Q88E52_PSEPK/1-73:0.22867,Q887T9_PSESM/1-73:0.30928);
RTP  ((((Q8EDY6_SHEON/1-75,Q87M79_VIBPA/1-75),Q8ZFD7_YERPE/1-75),YEBG_ECOLI/1-75),Q88E52_PSEPK/1-73,Q887T9_PSESM/1-73);
RTL  2.88397
LNK  Q87M79_VIBPA/1-75:Q87M79:BA000031
LNK  Q887T9_PSESM/1-73:Q887T9:AE016860
LNK  Q88E52_PSEPK/1-73:Q88E52:AE016791
LNK  Q8EDY6_SHEON/1-75:Q8EDY6:AE015702
LNK  Q8ZFD7_YERPE/1-75:Q8ZFD7:AJ414150
LNK  YEBG_ECOLI/1-75:P33220:L20897
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q8ZFD7_YERPE/1-75
ASQ  MAVEIKFVVVRQGEEKMTFTTKKEADAYDKMLDLADNLSEWLSQAPLSLEEEQREALSFFLAENKEALGQILRGS
DSQ  ATGGCCGTTGAAATAAAATTCGTCGTGGTGAGACAGGGTGAGGAAAAAATGACTTTCACAACCAAAAAAGAAGCCGATGCCTACGATAAGATGCTGGATTTGGCTGACAACTTGTCTGAATGGTTATCACAGGCTCCGCTGTCGCTAGAGGAAGAACAACGTGAAGCGTTAAGTTTCTTCTTGGCAGAAAATAAAGAAGCATTAGGGCAAATTCTACGCGGTAGT
TRN  10010101100011000
NAM  YEBG_ECOLI/1-75
ASQ  MAVEVKYVVIREGEEKMSFTSKKEADAYDKMLDTADLLDTWLTNSPVQMEDEQREALSLWLAEQKDVLSTILKTG
DSQ  ATGGCGGTTGAAGTTAAATACGTAGTCATTCGTGAGGGCGAAGAGAAAATGTCGTTTACCAGCAAAAAGGAAGCCGATGCTTATGACAAAATGCTTGATACGGCGGATCTGCTTGACACCTGGCTGACAAATTCTCCAGTGCAAATGGAAGACGAGCAACGTGAAGCCCTTTCGCTATGGCTGGCAGAACAAAAAGATGTGCTGAGCACCATTCTGAAAACCGGC
TRN  11011101101011011
NAM  Q87M79_VIBPA/1-75
ASQ  MAVIVKYVVERNGEEKMTFTSKAEADAYDKMLDMADELFTLLGKSELLEDEGKQEDLAMFLAQNKEELLYAIGAK
DSQ  ATGGCTGTAATCGTCAAGTACGTGGTAGAACGCAATGGAGAAGAGAAAATGACTTTTACCTCTAAAGCGGAAGCTGACGCATACGACAAAATGCTGGATATGGCAGATGAACTATTCACACTGCTAGGTAAAAGTGAACTTCTAGAAGACGAAGGCAAGCAAGAAGATCTTGCGATGTTCCTTGCGCAAAACAAAGAAGAGTTGCTTTACGCAATCGGTGCAAAA
TRN  11011101101011011
NAM  Q8EDY6_SHEON/1-75
ASQ  MAVITQFVVVREGVEKMTFTSKKEADAYDKMLDIADNLIPFIQNAQLGIDESLTEQLAFYFANNKDELTNLLKGV
DSQ  ATGGCAGTTATTACACAGTTTGTCGTGGTAAGAGAAGGGGTAGAAAAGATGACATTCACATCGAAAAAGGAGGCTGATGCCTACGATAAGATGCTCGATATCGCTGACAACCTCATTCCATTTATTCAAAACGCGCAGCTCGGAATTGATGAAAGTCTGACCGAACAGCTCGCATTCTATTTTGCTAACAATAAAGATGAGCTGACAAACTTGCTTAAAGGCGTC
TRN  10010101100011011
NAM  Q887T9_PSESM/1-73
ASQ  MAVETLYRSTRDLE--TTFVDRKLADAHDQMLELAELLTDVLIKNVPGLSEKHAEDASIYMAKNRAVFAAAFKNN
DSQ  ATGGCTGTTGAAACCCTTTACCGCAGTACCCGCGATCTGGAG------ACTACTTTCGTGGACCGTAAACTCGCCGATGCGCACGACCAAATGCTCGAGCTGGCCGAGCTTCTCACCGACGTCCTGATCAAGAACGTACCGGGGCTCTCGGAGAAGCATGCTGAGGATGCGAGCATCTATATGGCGAAGAATCGGGCCGTGTTTGCAGCGGCGTTCAAAAACAAC
TRN  11011101101011011
NAM  Q88E52_PSEPK/1-73
ASQ  MAVEVVYRSSRDPE--RLFMDKAEADRHDKMLELAERLAEVLHKAVPSLTEQQVEEAGIYMAKNRDVFARAFKSQ
DSQ  ATGGCCGTCGAAGTGGTGTACCGCAGCAGCCGCGACCCGGAG------CGCTTGTTCATGGATAAGGCCGAAGCAGACCGTCACGACAAGATGCTCGAACTGGCCGAGCGCCTGGCCGAAGTGCTGCACAAGGCGGTGCCGTCGCTGACCGAGCAGCAGGTCGAGGAAGCCGGTATCTACATGGCGAAGAACCGCGATGTGTTCGCCCGGGCGTTCAAAAGCCAG
TRN  11011101101011011
//