EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07109 - Mg-por_mtran_C)
FAM  PF07109
PID  Mg-por_mtran_C
DES  Magnesium-protoporphyrin IX methyltransferase C-terminus
IPR  IPR010940
ANO  15
ALN  101
AID  0.363231
APH  (((((((Q8DLN2_SYNEL/140-236:0.20741,((Q8YS90_ANASP/131-227:0.22400,(CHLM_SYNY3/133-229:0.11867,Q8GMR1_SYNP7/131-227:0.55315):0.04616):0.15407,(Q9MUE2_TOBAC/228-324:0.16999,Q9SNL7_ORYSA/224-320:0.22130):0.20285):0.09588):0.25369,Q8GE43_HELMO/132-228:0.59074):0.49966,Q93SV3_CHLTE/135-231:0.58961):0.66033,((Q8KZ59_9PROT/132-232:0.30516,Q8RTV9_9PROT/80-180:0.31902):0.16408,Q9L8J4_RHORU/132-232:0.31636):0.02250):0.10631,Q9JPA6_RHOGE/132-232:0.24639):0.35379,Q8KYZ6_9PROT/128-221:0.19824):0.23402,BCHM_RHOCA/131-224:0.31218,Q59780_RHOSH/129-222:0.19737);
ATP  (((((((Q8DLN2_SYNEL/140-236,((Q8YS90_ANASP/131-227,(CHLM_SYNY3/133-229,Q8GMR1_SYNP7/131-227)),(Q9MUE2_TOBAC/228-324,Q9SNL7_ORYSA/224-320))),Q8GE43_HELMO/132-228),Q93SV3_CHLTE/135-231),((Q8KZ59_9PROT/132-232,Q8RTV9_9PROT/80-180),Q9L8J4_RHORU/132-232)),Q9JPA6_RHOGE/132-232),Q8KYZ6_9PROT/128-221),BCHM_RHOCA/131-224,Q59780_RHOSH/129-222);
ATL  7.36375
DNO  15
DLN  303
DID  0.454625
DPH  ((((((((((Q8YS90_ANASP/131-227:0.28419,(CHLM_SYNY3/133-229:0.21311,Q8GMR1_SYNP7/131-227:0.45805):0.03888):0.10325,Q8DLN2_SYNEL/140-236:0.21496):0.16628,(Q9MUE2_TOBAC/228-324:0.27018,Q9SNL7_ORYSA/224-320:0.22693):0.13334):0.17625,Q8GE43_HELMO/132-228:0.49374):0.21720,Q93SV3_CHLTE/135-231:0.35885):0.39688,Q9L8J4_RHORU/132-232:0.14503):0.09617,(Q8KZ59_9PROT/132-232:0.32012,Q8RTV9_9PROT/80-180:0.28879):0.26915):0.06155,Q9JPA6_RHOGE/132-232:0.19062):0.19052,Q8KYZ6_9PROT/128-221:0.35766):0.13161,BCHM_RHOCA/131-224:0.23069,Q59780_RHOSH/129-222:0.19141);
DTP  ((((((((((Q8YS90_ANASP/131-227,(CHLM_SYNY3/133-229,Q8GMR1_SYNP7/131-227)),Q8DLN2_SYNEL/140-236),(Q9MUE2_TOBAC/228-324,Q9SNL7_ORYSA/224-320)),Q8GE43_HELMO/132-228),Q93SV3_CHLTE/135-231),Q9L8J4_RHORU/132-232),(Q8KZ59_9PROT/132-232,Q8RTV9_9PROT/80-180)),Q9JPA6_RHOGE/132-232),Q8KYZ6_9PROT/128-221),BCHM_RHOCA/131-224,Q59780_RHOSH/129-222);
DTL  6.22541
RID  0.363231
RPH  (((((((Q8DLN2_SYNEL/140-236:0.20741,((Q8YS90_ANASP/131-227:0.22400,(CHLM_SYNY3/133-229:0.11867,Q8GMR1_SYNP7/131-227:0.55315):0.04616):0.15407,(Q9MUE2_TOBAC/228-324:0.16999,Q9SNL7_ORYSA/224-320:0.22130):0.20285):0.09588):0.25369,Q8GE43_HELMO/132-228:0.59074):0.49966,Q93SV3_CHLTE/135-231:0.58961):0.66033,((Q8KZ59_9PROT/132-232:0.30516,Q8RTV9_9PROT/80-180:0.31902):0.16408,Q9L8J4_RHORU/132-232:0.31636):0.02250):0.10631,Q9JPA6_RHOGE/132-232:0.24639):0.35379,Q8KYZ6_9PROT/128-221:0.19824):0.23402,BCHM_RHOCA/131-224:0.31218,Q59780_RHOSH/129-222:0.19737);
RTP  (((((((Q8DLN2_SYNEL/140-236,((Q8YS90_ANASP/131-227,(CHLM_SYNY3/133-229,Q8GMR1_SYNP7/131-227)),(Q9MUE2_TOBAC/228-324,Q9SNL7_ORYSA/224-320))),Q8GE43_HELMO/132-228),Q93SV3_CHLTE/135-231),((Q8KZ59_9PROT/132-232,Q8RTV9_9PROT/80-180),Q9L8J4_RHORU/132-232)),Q9JPA6_RHOGE/132-232),Q8KYZ6_9PROT/128-221),BCHM_RHOCA/131-224,Q59780_RHOSH/129-222);
RTL  7.36375
LNK  BCHM_RHOCA/131-224:P26236:Z11165
LNK  CHLM_SYNY3/133-229:Q55467:D64006
LNK  Q59780_RHOSH/129-222:Q59780:X81413
LNK  Q8DLN2_SYNEL/140-236:Q8DLN2:BA000039
LNK  Q8GE43_HELMO/132-228:Q8GE43:AY142776
LNK  Q8GMR1_SYNP7/131-227:Q8GMR1:X04616
LNK  Q8KYZ6_9PROT/128-221:Q8KYZ6:AE008921
LNK  Q8KZ59_9PROT/132-232:Q8KZ59:AE008920
LNK  Q8RTV9_9PROT/80-180:Q8RTV9:AE008919
LNK  Q8YS90_ANASP/131-227:Q8YS90:BA000019
LNK  Q93SV3_CHLTE/135-231:Q93SV3:AY005136
LNK  Q9JPA6_RHOGE/132-232:Q9JPA6:AB034704
LNK  Q9L8J4_RHORU/132-232:Q9L8J4:AF202319
LNK  Q9MUE2_TOBAC/228-324:Q9MUE2:AF213968
LNK  Q9SNL7_ORYSA/224-320:Q9SNL7:AP000559
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q8YS90_ANASP/131-227
ASQ  CLDVLIHYPQEKADEMISHLCSLAQSRIILSFAPKTCALTLLKKIGSFFPGPSKTTRAYLHREADVIKILES----NGFAIQRKEFTKTRFYFSRILEATR
DSQ  TGCTTGGATGTACTCATTCACTACCCCCAAGAAAAAGCTGATGAAATGATTTCTCACCTCTGTTCTTTGGCACAGTCTAGAATCATTCTCAGTTTTGCACCCAAAACCTGCGCCTTGACTTTACTCAAGAAAATTGGCAGTTTCTTTCCTGGCCCAAGTAAAACCACCCGCGCCTATCTACACCGTGAAGCTGATGTCATCAAAATATTAGAAAGC------------AACGGCTTTGCTATTCAAAGAAAAGAGTTCACTAAAACTCGTTTCTACTTCTCCCGCATATTAGAAGCAACACGT
TRN  10010101110011010
NAM  CHLM_SYNY3/133-229
ASQ  CLDVLIHYPTEEASAMISHLASLADRRLILSFAPKTLGLTVLKKIGGLFPGPSKTTRAYQHKEADIRKILGD----NGFSIARTGMTSTRFYYSRILEAVR
DSQ  TGTCTGGATGTGTTGATTCACTATCCAACGGAGGAGGCGTCAGCGATGATTAGCCACTTGGCTTCCCTGGCTGATCGCCGTTTAATTTTGAGCTTTGCCCCCAAAACCCTGGGCTTGACGGTGTTGAAAAAAATTGGGGGACTGTTTCCCGGTCCCAGTAAGACCACCAGGGCCTATCAACATAAAGAAGCAGACATTCGCAAAATTTTGGGAGAT------------AACGGCTTTTCCATTGCCCGTACCGGCATGACCAGTACCCGTTTCTACTATTCCCGTATTTTAGAGGCGGTGCGC
TRN  10010101100011000
NAM  Q8DLN2_SYNEL/140-236
ASQ  CLDVLIHYPDNQMAGMLAHLSSLAMERLILSFAPKTPKYTLLKKIGEFFPGASKATRAYLHSEEFIVEILGN----LGWRIERNAMTKTRFYFSRLLEAVP
DSQ  TGCCTCGATGTCCTCATCCACTATCCCGACAACCAAATGGCAGGGATGCTAGCCCACTTGAGTTCTTTGGCCATGGAGCGGCTGATCCTCAGCTTTGCCCCCAAAACCCCAAAATATACGCTGCTGAAGAAGATCGGTGAATTCTTCCCTGGCGCCAGCAAGGCCACCCGTGCCTATCTCCACAGTGAGGAATTTATTGTGGAGATTTTGGGGAAC------------TTGGGTTGGCGGATTGAGCGCAATGCCATGACCAAAACTCGCTTTTACTTTTCGCGACTCCTAGAAGCAGTGCCA
TRN  11011101101011011
NAM  Q9SNL7_ORYSA/224-320
ASQ  CLDVLIHYPREEAKQMIRHLASLAEKRVLISFAPRTLYFDFLKRVGELFPGPSKATRAYLHSERDIEDALRD----AGWRVANRGFISTQFYFAKLFEAVP
DSQ  TGCCTCGACGTGCTGATCCACTACCCGCGGGAGGAGGCGAAGCAGATGATCCGGCACCTGGCGTCGCTGGCGGAGAAGCGGGTGCTCATCAGCTTCGCGCCCAGGACGCTCTACTTCGACTTCCTCAAGCGCGTCGGCGAGCTGTTCCCGGGGCCATCGAAGGCGACGCGCGCGTACCTGCACTCGGAGCGCGACATCGAGGACGCCCTGCGCGAC------------GCCGGGTGGCGCGTCGCCAACCGCGGCTTCATCTCCACGCAGTTCTACTTCGCCAAGCTCTTCGAGGCCGTCCCC
TRN  10010101100011011
NAM  Q9MUE2_TOBAC/228-324
ASQ  CLDVMIHYPQSKADGMIAHLASLAENRLILSFAPKTFYYDLLKRIGELFPGPSKATRAYLHAEADVERALQK----AGWKIRKRGLIATQFYFAKLIEAVP
DSQ  TGCTTAGATGTTATGATACATTACCCACAAAGTAAGGCTGATGGTATGATTGCTCATCTTGCGTCATTGGCTGAGAATCGTTTGATCCTGAGCTTCGCCCCAAAGACATTCTATTATGATTTGTTAAAAAGAATCGGAGAGTTGTTCCCTGGACCTTCAAAGGCTACACGAGCATATCTTCATGCAGAGGCTGACGTGGAGAGGGCACTGCAAAAA------------GCTGGGTGGAAGATAAGGAAGAGAGGCTTGATTGCCACACAATTTTACTTTGCAAAGCTTATTGAGGCTGTCCCT
TRN  10010101100011000
NAM  Q8GMR1_SYNP7/131-227
ASQ  CLDVLIHYPESDAAAMLSHLCSLAEQRVLVSFAPKSPVLNVLKRIGQFFPGASKTTRAYQHSETAIAASLSA----NGFPKCNVGPSTKHPSILLLLEAVR
DSQ  TGTTTGGATGTGTTGATTCACTATCCAGAATCCGACGCGGCGGCCATGTTGAGCCATCTTTGCAGCTTAGCTGAGCAACGGGTTTTGGTGAGCTTCGCGCCCAAATCCCCTGTCTTGAATGTGCTCAAGCGCATTGGACAGTTCTTCCCGGGGGCCAGCAAAACGACCCGCGCATATCAGCACAGTGAAACCGCGATCGCAGCAAGCCTTAGCGCG------------AATGGCTTTCCAAAGTGCAACGTCGGTCCTTCAACAAAGCACCCTTCTATTCTACTTCTGCTCGAAGCTGTCCGA
TRN  11011101101011000
NAM  Q8GE43_HELMO/132-228
ASQ  SMDVVIHYPLSDMPKLLGHILSLTKERAYISFAPSTAWFRFLKMIGERMSGSSRTTSAYLHPMTDIERILNE----LGYEITREKLVSNIIYNSMLLEIKP
DSQ  TCAATGGATGTTGTAATCCATTACCCCTTATCGGACATGCCTAAGCTGTTAGGACACATTTTGTCCTTAACAAAAGAAAGAGCTTACATTTCTTTTGCCCCATCGACAGCGTGGTTTCGCTTCCTGAAGATGATTGGGGAGCGGATGTCCGGAAGTTCACGGACCACTAGTGCCTATCTACATCCCATGACGGATATCGAAAGAATCTTGAATGAA------------CTGGGCTATGAAATCACTCGCGAGAAGCTAGTTTCCAACATCATTTATAACTCGATGCTGTTGGAAATTAAGCCG
TRN  10010101100011000
NAM  Q93SV3_CHLTE/135-231
ASQ  CFDVLIHYPAEGFAHAFSNLAGLTKGPIIFTYAPFNNILAFQHWIGGFFPKKERRTTIQMIKDKEMQRVLSE----LGLKIVSQQKISFGFYHTMLMHVAR
DSQ  TGTTTTGACGTCCTGATCCACTACCCGGCGGAAGGATTTGCCCATGCATTCAGCAACCTGGCGGGCCTCACCAAAGGACCAATCATCTTCACCTACGCCCCGTTCAACAACATCCTCGCCTTCCAGCACTGGATCGGCGGCTTCTTCCCGAAAAAAGAGCGCCGCACCACCATCCAGATGATCAAGGACAAGGAGATGCAGCGGGTGCTCAGTGAA------------CTCGGCCTCAAGATCGTCAGCCAGCAAAAGATAAGCTTCGGCTTTTACCACACGATGCTGATGCACGTGGCTCGC
TRN  10010101100011011
NAM  Q8RTV9_9PROT/80-180
ASQ  AMDSLIHYESEDGLRTLAAMAETVTTSIVFTFAPKTPLLAAMHSVGQLFPRGNRSPAIAPMALSQLQRAVASQPEFTEWEMARDFRVSRGFYISHAMELTR
DSQ  GCGATGGATTCCTTGATTCATTACGAGTCGGAAGATGGGCTGCGAACACTTGCGGCGATGGCTGAGACAGTCACAACGAGTATTGTGTTTACATTTGCACCAAAAACTCCGCTGCTAGCGGCGATGCATAGTGTTGGTCAGTTGTTTCCTCGAGGCAATAGATCACCTGCTATAGCACCGATGGCTTTATCGCAGCTTCAGCGTGCCGTAGCCTCTCAGCCGGAGTTCACGGAATGGGAAATGGCCCGAGATTTTCGGGTGTCTAGGGGGTTCTATATTTCTCATGCCATGGAATTGACCCGC
TRN  10010101100011000
NAM  Q8KZ59_9PROT/132-232
ASQ  AMDSIIHYAAKDGLKTLETLASTVNASMVFTFAPKTIPLAAMHAIGKLFPRSDRAPAIEPIAPHNLRRSITTSEALLDWQVSRERRVSTGFYTSQAMELVK
DSQ  GCCATGGACTCGATTATTCACTACGCCGCTAAGGACGGTCTAAAAACATTAGAGACTCTGGCATCGACTGTTAATGCCTCAATGGTCTTCACGTTTGCTCCAAAAACAATTCCGTTGGCGGCAATGCATGCGATTGGCAAATTGTTTCCTAGAAGTGATCGAGCGCCTGCTATTGAGCCTATTGCTCCGCACAACTTGCGCCGGTCGATAACTACTTCAGAGGCGCTGTTAGATTGGCAGGTGTCTCGTGAACGTCGCGTTTCAACAGGGTTTTACACGTCACAAGCGATGGAGTTGGTAAAA
TRN  10010101100011000
NAM  Q9L8J4_RHORU/132-232
ASQ  AMDSLIHYQAADTVQVLERLAARTSKTMVFTFAPRTPMLSVMHAVGKLFPRGDRAPAIQPLGEKSFRWKIVGEAGLADWSLGRTQRVKCGFYISQALELVR
DSQ  GCCATGGATTCGCTGATCCACTATCAGGCGGCCGATACGGTCCAGGTTCTGGAACGGCTGGCGGCGCGCACCTCCAAGACCATGGTCTTCACCTTCGCCCCGCGCACGCCGATGCTGTCGGTGATGCATGCGGTGGGCAAGCTGTTCCCGCGCGGCGACCGCGCTCCGGCCATCCAGCCGCTTGGCGAGAAAAGCTTCCGCTGGAAGATCGTCGGCGAGGCCGGTCTGGCCGATTGGTCGTTGGGGCGGACGCAGCGGGTGAAGTGCGGCTTCTACATTTCCCAGGCGCTGGAGCTTGTCCGG
TRN  11011101101011011
NAM  Q9JPA6_RHOGE/132-232
ASQ  AMDSVIHYDAPDAVAALSRLAERTSTSMVFTFAPRTALLSLMWTVGKLFPRGDRSPAIVPVAPEQLRSLMAAHPGLQGWQWGRSERISSGFYTSQATEWKR
DSQ  GCGATGGACTCGGTGATCCACTACGACGCACCCGACGCCGTCGCCGCGCTGTCCCGGCTCGCCGAGCGCACCTCGACCTCGATGGTCTTCACCTTCGCGCCGCGCACCGCGCTGCTGTCGCTGATGTGGACCGTCGGCAAGCTGTTCCCGCGTGGCGACCGTTCGCCGGCCATCGTGCCGGTGGCGCCCGAGCAGCTGCGTTCGCTGATGGCGGCGCACCCCGGCCTGCAAGGCTGGCAGTGGGGCCGCAGCGAACGCATCTCCAGCGGCTTCTACACCTCGCAGGCCACGGAGTGGAAACGC
TRN  11011101101011011
NAM  Q8KYZ6_9PROT/128-221
ASQ  AMDSLIYYSAEDIGATLDRVSSRILTNMVFTVAPRTPLLMAMWRIGKLFPRNDRSPMMVPHQMAQIAKSTSG-------QISDIDRVASGFYISQALEFRP
DSQ  GCAATGGACAGTTTGATTTATTACTCGGCTGAAGACATTGGCGCGACCCTCGACCGGGTGAGTAGCCGGATATTGACAAATATGGTCTTTACGGTTGCGCCGCGCACGCCGCTTTTGATGGCCATGTGGCGGATTGGCAAATTGTTTCCACGCAACGATCGCTCGCCGATGATGGTGCCGCATCAAATGGCACAGATCGCCAAATCTACCTCGGGT---------------------CAGATCAGTGACATCGATCGGGTGGCCTCTGGGTTTTACATCAGCCAAGCGTTGGAATTCCGCCCA
TRN  10010101110011011
NAM  Q59780_RHOSH/129-222
ASQ  AMDSLIYYTDADIAAALDRLGARTRHSVVFTVAPRTPFLMAFWTMGKLFPRSDRSPVMIPHPFQPLNEA-------TGGRLVKVGRVSRGFYISECLEFRP
DSQ  GCGATGGACAGCCTGATCTACTACACCGACGCCGACATCGCGGCGGCGCTCGACAGGCTCGGCGCCAGAACGCGGCATTCGGTCGTCTTTACCGTGGCCCCGCGAACGCCTTTCCTGATGGCGTTCTGGACGATGGGGAAGCTCTTTCCGCGGTCCGACCGCTCGCCGGTCATGATCCCGCACCCGTTCCAGCCTCTGAACGAGGCG---------------------ACGGGGGGCAGGCTTGTGAAGGTCGGGCGGGTGTCGCGGGGCTTCTACATCTCCGAGTGTCTGGAGTTCCGGCCG
TRN  10010101100011011
NAM  BCHM_RHOCA/131-224
ASQ  AMDSLIYYRAPDIGRVLTELGKRTHSAIVFTVAPKTAFLMAFWWLGKLFPRSNRSPVMIPHALDKLQRHAGD-------SLIKIDRVARGFYISECLEYRP
DSQ  GCGATGGACAGCCTGATCTATTACCGCGCGCCGGATATCGGCCGGGTGCTGACGGAACTGGGCAAGCGCACGCACAGCGCCATCGTCTTCACCGTCGCGCCGAAAACGGCCTTCCTGATGGCGTTCTGGTGGCTGGGCAAGCTTTTCCCGCGCTCGAACCGCTCGCCGGTGATGATCCCGCATGCGCTGGACAAGCTGCAGCGCCATGCGGGCGAC---------------------AGCCTGATCAAGATCGACCGCGTCGCGCGCGGTTTCTACATCTCGGAATGCCTGGAGTATCGGCCA
TRN  11011101101011011
//