EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07071 - DUF1341)
FAM  PF07071
PID  DUF1341
DES  Protein of unknown function (DUF1341)
IPR  IPR010763
ANO  5
ALN  223
AID  0.408562
APH  (Q8ZL28_SALTY/7-227:0.37394,(Q8ELL9_OCEIH/6-221:0.34991,(Q8ZK42_SALTY/8-209:0.43508,Q88ZQ6_LACPL/8-225:0.25516):0.14441):0.26592,Q8Y429_LISMO/12-220:1.02997);
ATP  (Q8ZL28_SALTY/7-227,(Q8ELL9_OCEIH/6-221,(Q8ZK42_SALTY/8-209,Q88ZQ6_LACPL/8-225)),Q8Y429_LISMO/12-220);
ATL  2.85439
DNO  5
DLN  669
DID  0.478537
DPH  ((Q8ZL28_SALTY/7-227:0.39852,Q8Y429_LISMO/12-220:0.65594):0.18196,(Q88ZQ6_LACPL/8-225:0.29896,Q8ZK42_SALTY/8-209:0.40664):0.08408,Q8ELL9_OCEIH/6-221:0.30365);
DTP  ((Q8ZL28_SALTY/7-227,Q8Y429_LISMO/12-220),(Q88ZQ6_LACPL/8-225,Q8ZK42_SALTY/8-209),Q8ELL9_OCEIH/6-221);
DTL  2.32975
RID  0.408562
RPH  (Q8ZL28_SALTY/7-227:0.37394,(Q8ELL9_OCEIH/6-221:0.34991,(Q8ZK42_SALTY/8-209:0.43508,Q88ZQ6_LACPL/8-225:0.25516):0.14441):0.26592,Q8Y429_LISMO/12-220:1.02997);
RTP  (Q8ZL28_SALTY/7-227,(Q8ELL9_OCEIH/6-221,(Q8ZK42_SALTY/8-209,Q88ZQ6_LACPL/8-225)),Q8Y429_LISMO/12-220);
RTL  2.85439
LNK  Q88ZQ6_LACPL/8-225:Q88ZQ6:AL935252
LNK  Q8ELL9_OCEIH/6-221:Q8ELL9:BA000028
LNK  Q8Y429_LISMO/12-220:Q8Y429:AL591984
LNK  Q8ZK42_SALTY/8-209:Q8ZK42:AE008908
LNK  Q8ZL28_SALTY/7-227:Q8ZL28:AE008875
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q8Y429_LISMO/12-220
ASQ  WNNFALFNFLAKDKENSLEVMVAARGFAVPGIVATNYETAEEAANVVKELQTTAE-VISVGLGGGGDWQNWRDVLHIARLAPNSHINQPIETAGLTNGLL-----PETYTNALVRPTGKVGIVKLSSGD--------EITAEEAVDYCLSANIPSIKFMSIEGTKYLDELVYLTKIAADKGIYGIEPAGGIGADNILEITTAIKSTGIPFYMPHIFGKTIDKA
DSQ  TGGAATAATTTTGCGCTATTTAATTTTTTAGCGAAAGATAAGGAAAATAGCCTGGAAGTCATGGTGGCAGCGCGCGGTTTTGCCGTTCCAGGAATCGTTGCAACGAACTATGAAACAGCAGAAGAAGCCGCAAATGTGGTGAAAGAACTACAAACTACTGCTGAG---GTCATTAGTGTTGGCCTTGGTGGTGGCGGAGACTGGCAAAACTGGCGCGATGTTCTTCATATTGCTCGTCTGGCTCCAAACAGTCATATTAACCAGCCAATCGAAACCGCGGGATTAACAAATGGCTTACTC---------------CCGGAAACATACACTAATGCACTCGTTCGACCAACCGGAAAAGTAGGTATTGTAAAACTATCTTCCGGAGAT------------------------GAAATTACCGCTGAAGAAGCTGTCGATTATTGTCTATCCGCCAACATCCCGTCCATTAAATTTATGAGCATTGAAGGCACGAAATATTTAGATGAACTAGTTTACTTAACAAAAATTGCAGCAGATAAAGGCATTTACGGTATTGAGCCAGCGGGAGGAATTGGAGCTGACAATATTCTTGAAATAACAACCGCCATCAAGTCCACAGGAATTCCGTTTTACATGCCACATATTTTCGGAAAAACAATTGACAAAGCA
TRN  10010101100011010
NAM  Q8ZL28_SALTY/7-227
ASQ  YRQRVAINVLAKDIANAKAIYEAAEGHAVIGVLSAQFATVEEGVPEVKRWMAEVP-SISVGL-GAGDPAQYYKAAMIAAHTHPAHVNQTFTGSGFAAGALAATGGEQTHINALVSPTGTPGEVVISTGVSSSQGTPARVSCEAAVRMMQDMGAHAAKFFPMGGEKSLPELYALATTAARHGMTLIEPTGGISLDNFGIILQTCLEAGVPRVMPHVYSSIIDPQ
DSQ  TATCGTCAGCGGGTAGCGATTAACGTGCTGGCAAAGGATATCGCCAACGCGAAGGCTATCTATGAAGCCGCCGAAGGCCATGCGGTCATTGGCGTACTTTCCGCGCAGTTCGCTACGGTAGAAGAGGGCGTGCCGGAGGTGAAACGCTGGATGGCGGAGGTGCCG---TCTATCTCAGTGGGTCTG---GGCGCAGGCGACCCGGCGCAGTACTACAAAGCGGCGATGATTGCCGCCCATACTCACCCGGCCCATGTCAACCAGACCTTTACCGGCAGCGGCTTCGCGGCGGGCGCGCTGGCGGCGACGGGCGGCGAGCAAACGCATATCAACGCCCTGGTCAGCCCGACGGGAACGCCTGGCGAGGTGGTGATTTCTACCGGCGTCAGCAGCAGCCAGGGAACGCCAGCCCGCGTTTCCTGTGAAGCGGCGGTACGCATGATGCAGGATATGGGCGCACATGCGGCGAAGTTTTTCCCGATGGGCGGCGAAAAGTCGTTACCGGAATTATATGCGCTGGCGACAACCGCTGCCCGCCACGGCATGACGCTTATCGAGCCGACCGGCGGTATCTCACTGGATAATTTCGGTATTATCCTGCAAACCTGCCTGGAAGCAGGCGTGCCGCGCGTCATGCCGCATGTTTACAGCTCGATTATCGATCCGCAA
TRN  11011101101011000
NAM  Q8ELL9_OCEIH/6-221
ASQ  YNDRICLNVLASDITNAKEIYEATDGHVLIGLLSSNYTSVQEALEDIRVYDKVLDGSISLGL-GGGNPEQWKMVADISREYKPRHINQVFPKVGYTRAAV---NHAQTMINSLVKPTGQPGLVDIATGP--TNKSLIIVEVEAAIQLTKEMGGNSLKFFPMGGTSRLEEYEAVAKACAKEDFYL-EPTGGIDVQNSPQIIEIALQAGVKKVIPHVYSSIIDGS
DSQ  TATAACGATCGAATTTGTTTAAATGTATTAGCTTCCGATATAACAAATGCAAAAGAAATCTATGAAGCAACCGATGGTCATGTACTTATCGGGTTATTATCAAGCAATTATACAAGCGTACAAGAAGCGTTAGAAGATATAAGGGTGTATGATAAAGTACTAGATGGATCCATTTCTCTTGGTTTA---GGTGGTGGGAACCCGGAACAATGGAAGATGGTTGCAGATATTAGTCGTGAGTATAAACCAAGACATATTAATCAAGTTTTCCCAAAAGTAGGATATACAAGAGCGGCTGTA---------AATCATGCTCAAACGATGATTAATAGCCTCGTAAAGCCAACTGGCCAACCAGGTCTTGTCGACATTGCTACTGGTCCA------ACGAATAAATCTCTTATTATCGTAGAAGTAGAAGCAGCGATTCAGCTAACAAAAGAAATGGGAGGGAATTCATTGAAGTTCTTTCCAATGGGTGGAACGAGTCGTTTAGAAGAGTATGAAGCAGTAGCTAAGGCTTGTGCAAAAGAAGACTTTTATTTA---GAGCCAACAGGGGGAATAGATGTTCAAAATAGTCCACAAATTATTGAAATTGCCCTTCAAGCAGGTGTGAAGAAAGTTATTCCACATGTCTATTCATCTATTATCGATGGATCT
TRN  10010101110011000
NAM  Q8ZK42_SALTY/8-209
ASQ  YRDRVCLNVLAGSKDNAREIYAAAEGHVLVGVLSKNYPDVASAVADMREYAALIDNALSVGL-GAGDPNQSAMVSEISRQVQPQHVNQVFTGVGTSRALL---GQNETVVNGLVSPTGTPGLVKISTGPLSSRAPDGIVPIETAIALLKDMGGSSVKYFPMGGLTCRDEYKAVA-----------EPAPAMISGWNRRAV------SIWKTSPRFCTSPLMQV
DSQ  TACCGCGATCGCGTTTGCCTGAACGTACTGGCCGGTTCGAAAGATAACGCCCGGGAAATCTACGCGGCGGCGGAAGGTCATGTGCTGGTTGGCGTGCTCTCCAAAAACTATCCGGATGTGGCAAGCGCAGTCGCGGATATGCGTGAATATGCGGCGCTTATCGATAATGCGCTCTCCGTCGGACTG---GGGGCAGGCGATCCTAACCAGTCGGCGATGGTGAGCGAAATCTCGCGTCAGGTACAGCCGCAGCATGTCAACCAGGTGTTTACCGGCGTAGGAACCAGCCGGGCGCTGCTG---------GGGCAAAATGAGACGGTGGTGAACGGTCTTGTCTCGCCGACCGGCACGCCGGGGCTGGTGAAAATTTCCACCGGCCCGCTAAGCAGCCGCGCGCCGGACGGCATCGTACCCATAGAAACGGCGATTGCGCTACTCAAAGACATGGGCGGCAGCTCTGTTAAATACTTTCCGATGGGAGGACTCACCTGTCGCGACGAGTATAAAGCGGTAGCT---------------------------------GAGCCTGCGCCCGCCATGATTTCTGGCTGGAACCGACGGGCGGTA------------------TCGATCTGGAAAACTTCGCCGAGATTCTGCACATCGCCCTTGATGCAGGTG
TRN  10010101100011011
NAM  Q88ZQ6_LACPL/8-225
ASQ  LPNGICLNVLANSVTNAEACYAAAEGHVVLGVLTKNYLSDESAITDMRRYQAAVNNAVSVGL-GAGSPQQSAMVARVAAEIQPQHVNQVFTGVATSRALL---GQADTVINGLVAPSGEVGLVNVATGPLSSQSAKANIPVATAITMLKDMGGTSLKYFPMQGTAHLEEFKAVAAACADNEFGL-EPTGGLDLTNFQQIVQIAVAAGVRQIIPHVYSSIIDAT
DSQ  TTACCAAATGGGATTTGTTTGAACGTATTGGCTAATTCAGTGACGAACGCGGAAGCTTGTTATGCAGCTGCGGAAGGACACGTGGTGTTGGGTGTCCTCACGAAAAACTATCTGAGTGATGAGTCTGCCATTACTGATATGCGGCGTTACCAAGCCGCAGTGAACAATGCAGTTTCGGTTGGTTTA---GGTGCTGGTTCACCGCAACAAAGTGCAATGGTGGCGCGAGTTGCCGCAGAAATCCAGCCACAACATGTTAATCAAGTCTTCACTGGTGTGGCGACTAGCCGGGCGTTGCTA---------GGTCAAGCCGATACTGTGATTAATGGGCTAGTCGCGCCGAGTGGTGAAGTCGGTTTGGTCAATGTGGCAACGGGGCCACTTAGTTCGCAGTCAGCAAAAGCGAATATTCCCGTTGCAACCGCAATTACAATGCTCAAGGATATGGGCGGGACGTCACTGAAGTACTTTCCAATGCAAGGAACGGCTCACCTGGAAGAATTTAAAGCAGTGGCTGCGGCGTGTGCTGACAATGAATTTGGTCTA---GAACCAACCGGTGGACTGGATCTCACTAATTTCCAACAGATTGTACAGATTGCGGTCGCCGCTGGGGTACGGCAGATTATTCCCCATGTATACAGTTCGATTATCGATGCAACT
TRN  11011101101011000
//