EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06813 - Nodulin-like)
FAM  PF06813
PID  Nodulin-like
DES  Nodulin-like
IPR  IPR010658
ANO  15
ALN  259
AID  0.356674
APH  ((((((((Q9ZUV4_ARATH/17-262:0.21576,(O80960_ARATH/21-266:0.20761,O81120_LOTJA/26-271:0.42609):0.05327):0.15604,Q8S746_ORYSA/34-288:0.32999):0.49641,(O81121_ARATH/16-263:0.28194,Q9LUF8_ARATH/16-265:0.34502):0.22843):0.31830,(Q8H6R3_9ROSI/13-260:0.18151,(Q8H613_ORYSA/14-261:0.39555,Q9M8M1_ARATH/13-260:0.32300):0.05568):0.40413):0.18944,Q9SLF1_ARATH/14-260:0.41597):0.48111,(O22926_ARATH/7-235:0.37346,Q94D97_ORYSA/8-252:0.56755):0.33372):0.35008,Q8H132_ARATH/7-253:0.16413):0.12350,Q9SS92_ARATH/41-290:0.34442,Q9C862_ARATH/7-251:0.10511);
ATP  ((((((((Q9ZUV4_ARATH/17-262,(O80960_ARATH/21-266,O81120_LOTJA/26-271)),Q8S746_ORYSA/34-288),(O81121_ARATH/16-263,Q9LUF8_ARATH/16-265)),(Q8H6R3_9ROSI/13-260,(Q8H613_ORYSA/14-261,Q9M8M1_ARATH/13-260))),Q9SLF1_ARATH/14-260),(O22926_ARATH/7-235,Q94D97_ORYSA/8-252)),Q8H132_ARATH/7-253),Q9SS92_ARATH/41-290,Q9C862_ARATH/7-251);
ATL  7.89087
DNO  15
DLN  777
DID  0.461725
DPH  (Q9ZUV4_ARATH/17-262:0.26731,(O81120_LOTJA/26-271:0.37010,O80960_ARATH/21-266:0.20717):0.05482,((((((O22926_ARATH/7-235:0.30223,Q94D97_ORYSA/8-252:0.44271):0.18114,(Q8H132_ARATH/7-253:0.23925,(Q9C862_ARATH/7-251:0.14485,Q9SS92_ARATH/41-290:0.31709):0.07352):0.25874):0.23512,Q9SLF1_ARATH/14-260:0.35604):0.13658,(Q8H613_ORYSA/14-261:0.27345,(Q8H6R3_9ROSI/13-260:0.22656,Q9M8M1_ARATH/13-260:0.28840):0.08432):0.23225):0.17632,(O81121_ARATH/16-263:0.22294,Q9LUF8_ARATH/16-265:0.32705):0.11462):0.26197,Q8S746_ORYSA/34-288:0.29084):0.13507);
DTP  (Q9ZUV4_ARATH/17-262,(O81120_LOTJA/26-271,O80960_ARATH/21-266),((((((O22926_ARATH/7-235,Q94D97_ORYSA/8-252),(Q8H132_ARATH/7-253,(Q9C862_ARATH/7-251,Q9SS92_ARATH/41-290))),Q9SLF1_ARATH/14-260),(Q8H613_ORYSA/14-261,(Q8H6R3_9ROSI/13-260,Q9M8M1_ARATH/13-260))),(O81121_ARATH/16-263,Q9LUF8_ARATH/16-265)),Q8S746_ORYSA/34-288));
DTL  6.22045
RID  0.356674
RPH  ((((((((Q9ZUV4_ARATH/17-262:0.21576,(O80960_ARATH/21-266:0.20761,O81120_LOTJA/26-271:0.42609):0.05327):0.15604,Q8S746_ORYSA/34-288:0.32999):0.49641,(O81121_ARATH/16-263:0.28194,Q9LUF8_ARATH/16-265:0.34502):0.22843):0.31830,(Q8H6R3_9ROSI/13-260:0.18151,(Q8H613_ORYSA/14-261:0.39555,Q9M8M1_ARATH/13-260:0.32300):0.05568):0.40413):0.18944,Q9SLF1_ARATH/14-260:0.41597):0.48111,(O22926_ARATH/7-235:0.37346,Q94D97_ORYSA/8-252:0.56755):0.33372):0.35008,Q8H132_ARATH/7-253:0.16413):0.12350,Q9SS92_ARATH/41-290:0.34442,Q9C862_ARATH/7-251:0.10511);
RTP  ((((((((Q9ZUV4_ARATH/17-262,(O80960_ARATH/21-266,O81120_LOTJA/26-271)),Q8S746_ORYSA/34-288),(O81121_ARATH/16-263,Q9LUF8_ARATH/16-265)),(Q8H6R3_9ROSI/13-260,(Q8H613_ORYSA/14-261,Q9M8M1_ARATH/13-260))),Q9SLF1_ARATH/14-260),(O22926_ARATH/7-235,Q94D97_ORYSA/8-252)),Q8H132_ARATH/7-253),Q9SS92_ARATH/41-290,Q9C862_ARATH/7-251);
RTL  7.89087
LNK  O22926_ARATH/7-235:O22926:AC002338
LNK  O80960_ARATH/21-266:O80960:AC004697
LNK  O81120_LOTJA/26-271:O81120:AF031243
LNK  O81121_ARATH/16-263:O81121:AF031244
LNK  Q8H132_ARATH/7-253:Q8H132:BT000872
LNK  Q8H613_ORYSA/14-261:Q8H613:AP003019
LNK  Q8H6R3_9ROSI/13-260:Q8H6R3:AF506028
LNK  Q8S746_ORYSA/34-288:Q8S746:AC090488
LNK  Q94D97_ORYSA/8-252:Q94D97:AP003315
LNK  Q9C862_ARATH/7-251:Q9C862:AC027135
LNK  Q9LUF8_ARATH/16-265:Q9LUF8:AB023037
LNK  Q9M8M1_ARATH/13-260:Q9M8M1:AC018849
LNK  Q9SLF1_ARATH/14-260:Q9SLF1:AC005825
LNK  Q9SS92_ARATH/41-290:Q9SS92:AC009325
LNK  Q9ZUV4_ARATH/17-262:Q9ZUV4:AC005851
AMK  xxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9ZUV4_ARATH/17-262
ASQ  RWFMVFASFLIMACAGATYLFG.TYSKDIKSTLGYDQTTLNLLGFFKDLGANVGVLSGLIAEVTPTWFVLTIGSAMNFVGYFMIWLTVTGKVAKPKVWQMCLYICIGANSQNFANTGALVTCVKNFPESRGVMLGLLKGYVGLSGAIFTQLYFAIYGH---.DSKSLILLIAWLPAAVSLVFVYLIREK-------KVVRQRNELSVFYQFLYISIFLALFLMAMNIAEKQVHFSKAAYAASATICC.ALLFVPLTVSV
DSQ  AGATGGTTCATGGTGTTTGCTTCGTTTCTCATCATGGCTTGCGCTGGAGCCACCTACCTTTTTGGT...ACTTACTCTAAAGATATCAAATCTACACTTGGTTACGATCAGACCACGTTGAACCTCTTAGGTTTCTTTAAAGATCTTGGAGCAAACGTTGGTGTCTTGTCCGGTCTAATAGCTGAGGTCACACCGACTTGGTTCGTCCTCACCATTGGCTCGGCGATGAACTTCGTCGGTTACTTTATGATCTGGCTTACCGTAACCGGCAAAGTCGCTAAGCCAAAGGTTTGGCAAATGTGTCTTTATATTTGTATAGGAGCCAACTCGCAGAACTTTGCAAACACAGGAGCTTTGGTTACTTGTGTTAAGAATTTCCCTGAGAGCAGAGGAGTTATGCTTGGTTTGCTTAAGGGTTATGTTGGACTAAGTGGTGCAATCTTCACGCAGCTTTATTTTGCGATCTATGGACAC---------...GATTCCAAGTCTTTGATCTTGTTGATAGCATGGTTGCCTGCTGCGGTTTCTCTTGTGTTTGTGTATTTGATAAGAGAGAAG---------------------AAGGTTGTGAGGCAGAGGAATGAGCTTAGTGTGTTTTACCAATTCCTTTATATTTCTATATTCTTGGCTTTGTTCCTTATGGCAATGAACATTGCTGAGAAGCAAGTTCATTTCTCAAAAGCCGCTTATGCGGCTAGCGCTACGATATGTTGT...GCTTTGCTTTTTGTGCCTCTTACGGTTTCCGTT
TRN  10010101110011000
NAM  O80960_ARATH/21-266
ASQ  RWFMFFGSLLIMSTAGATYMFG.IYSGDIKETLGYDQTTLNLLSFFKDLGANVGVLAGLLNEVTPPWFILLIGAILNFFGYFMIWLAVTERISKPQVWHMCLYICVGANSQSFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYRAFYGE---.DTKELILMIGWLPAIVSFAFLRTIRIM-------KVKRQTNELKVFYNFLYISLGLATFLMVVIIINKLSGFTQSEFGGSAAVVI.VLLLLPIIVVI
DSQ  AGATGGTTCATGTTCTTTGGAAGTCTCTTAATCATGTCGACAGCTGGAGCCACTTACATGTTCGGT...ATCTACTCAGGCGATATCAAGGAAACCTTAGGCTACGACCAAACCACTCTTAATCTCCTAAGTTTCTTCAAAGATCTCGGAGCCAACGTTGGAGTCCTCGCGGGTCTACTCAATGAGGTAACTCCTCCTTGGTTCATCCTCTTGATCGGAGCCATCCTTAACTTCTTTGGATACTTCATGATTTGGCTCGCCGTCACGGAACGGATCTCGAAACCTCAAGTTTGGCACATGTGTCTCTATATCTGCGTTGGAGCCAACTCGCAGTCGTTCGCTAATACCGGATCTCTCGTCACGTGCGTTAAGAACTTCCCGGAGTCACGTGGGGTTGTCTTGGGGATTCTCAAAGGCTACGTTGGTCTTAGTGGCGCCATTATTACACAGCTCTACCGTGCCTTTTATGGTGAA---------...GACACAAAAGAGCTCATCTTGATGATTGGTTGGTTGCCGGCTATAGTCTCGTTTGCGTTTTTGAGAACGATAAGAATAATG---------------------AAAGTGAAAAGACAGACAAACGAACTAAAGGTGTTCTATAACTTCCTCTACATATCGCTCGGGCTTGCGACGTTTCTCATGGTGGTCATCATCATCAACAAACTCTCGGGCTTTACACAAAGCGAGTTTGGAGGTAGCGCCGCGGTAGTGATC...GTCTTACTTCTTTTGCCCATTATAGTCGTCATC
TRN  10010101110011000
NAM  O81120_LOTJA/26-271
ASQ  RWFMMLASFMIMAVSGASYMFS.LYSREIKFALGYDQSTLNLLSFFKDVGSNIGILSGLINEVTPPWVVLSMGAVLNFFGFFMIWLAVAKKIANPRVWHLCLYIVIGSNSHCFTNTAVMVTSVKNFPGIRGIVLGILGGYLSLSAIIITQLYYAFFIN---.DSQSMILIMACLPTATALILLPVIKNH-------KSIQQKNDSKVFYRFIYLVLALAGFLMIMIILQISFNFTQSEYYATTTVML.LLLTLPLAVVI
DSQ  AGATGGTTCATGATGCTTGCATCATTTATGATCATGGCAGTATCAGGAGCTAGCTACATGTTCAGC...CTCTACTCCAGAGAAATCAAGTTCGCTCTCGGGTATGACCAATCCACTCTCAATTTGTTAAGCTTCTTCAAGGACGTGGGTTCCAACATAGGCATTCTCTCTGGTCTAATCAATGAGGTAACGCCTCCTTGGGTTGTGTTATCAATGGGTGCTGTTCTAAATTTTTTTGGGTTTTTCATGATTTGGCTTGCTGTGGCCAAAAAAATTGCAAATCCCCGCGTGTGGCACCTGTGCTTGTACATCGTTATTGGAAGCAATTCTCATTGTTTTACCAACACTGCAGTTATGGTGACCAGCGTAAAGAATTTCCCGGGCATCCGCGGCATTGTATTAGGCATTTTGGGTGGGTATCTTAGTTTGAGTGCAATAATCATCACTCAACTGTACTATGCCTTCTTTATAAAT---------...GACTCCCAATCTATGATTTTGATCATGGCATGTCTACCAACAGCCACTGCTTTGATTCTCCTACCAGTTATAAAGAACCAC---------------------AAGAGTATTCAACAGAAAAATGACTCCAAAGTTTTCTATAGGTTCATCTACTTGGTACTAGCTCTTGCAGGGTTCCTCATGATTATGATCATTTTGCAAATATCTTTCAACTTCACCCAGAGTGAGTATTATGCCACTACCACTGTGATGCTT...CTCTTACTTACCCTTCCACTTGCTGTTGTTATT
TRN  10010101100011000
NAM  Q8S746_ORYSA/34-288
ASQ  RWFMMLACMVIMSASGGTNIFS.IYSGALKSSLGYDQRTLNTLSFFKELGANAGIVSGLVAEVAPPSAVLAVGACMSLAGYLVVYLAVAGRVARPPLWLMCACISAGADSQAFANTGALVTCVKSFPESRGVVVGLLKGFAGLSGAVLPQLYLAIYGGGH-.DAGSLILLIAWLPAAISLVFLRVVRVMPHRPTNGRVGGGGSNGPIFSFLY-ISFAVASYLLVMIVLQKTISFSHAAYAATAIVLLlILLLLPLAVVI
DSQ  CGGTGGTTCATGATGCTCGCGTGCATGGTGATCATGTCGGCGTCGGGCGGCACCAACATCTTCAGC...ATCTACTCCGGCGCGCTCAAGTCGTCGCTGGGCTACGACCAACGGACGCTCAACACGCTCTCCTTCTTCAAGGAGCTCGGCGCCAACGCCGGCATCGTCTCCGGCCTCGTCGCCGAGGTGGCGCCGCCGTCGGCCGTGCTCGCCGTGGGCGCCTGCATGAGCCTCGCGGGCTACCTCGTCGTCTACCTCGCCGTCGCCGGCCGCGTCGCGCGCCCGCCGCTCTGGCTCATGTGCGCCTGCATCTCCGCCGGCGCCGACTCGCAGGCCTTCGCCAACACCGGCGCGCTCGTCACCTGCGTCAAGAGCTTCCCGGAGAGCCGCGGCGTCGTCGTCGGCCTCCTCAAGGGGTTCGCCGGGCTCAGCGGCGCCGTCCTCCCGCAGCTCTACCTCGCCATCTACGGCGGCGGCCAC---...GACGCCGGGTCGCTGATACTGCTCATCGCCTGGCTCCCCGCCGCCATCTCCCTCGTGTTCCTCCGCGTCGTCCGCGTCATGCCGCACCGGCCGACGAACGGCCGCGTCGGCGGCGGAGGCAGCAATGGCCCCATCTTCTCCTTCCTCTAC---ATCTCCTTCGCCGTCGCCTCCTACCTCCTCGTCATGATCGTGCTCCAGAAAACCATCAGCTTCTCGCACGCCGCCTACGCCGCGACGGCCATCGTGCTCCTCctcATCCTCCTCCTCCTCCCCCTCGCGGTCGTCATC
TRN  10010101100011011
NAM  Q9LUF8_ARATH/16-265
ASQ  RWLVFVCAMWVQSVAGVGYLFGgSMSPAIKTSLGYNQKQIALLGVAKNLGDAIGFVSGALSEVSPSWVVLLVGATQNLFGYGVVWLVVTGQLPNLPLWMLFVAIFVGTNGETYYNTASLVSCIHNFPESRGPVVGILKGFSGLSGAILTQVYLMFNPS---.HDSSVILMVALGPPVVVLALLFIVRPVERSC----RTNLRSDDLRFLAIYGFCVVLAVYLLGLLVLQSVFDMTQTIITTSGAILV.IFMVVPVLVPF
DSQ  CGATGGCTAGTTTTCGTCTGCGCCATGTGGGTCCAATCCGTCGCCGGCGTTGGCTATCTATTCGGCggcTCTATGTCTCCGGCAATCAAGACTTCCCTTGGCTACAATCAGAAACAGATCGCTCTTCTCGGCGTAGCTAAAAACCTCGGTGACGCCATCGGATTCGTCTCCGGTGCTTTATCTGAAGTCTCACCTTCCTGGGTGGTTCTACTCGTCGGTGCAACTCAGAACCTTTTCGGCTACGGTGTTGTTTGGCTCGTCGTCACTGGCCAATTGCCTAATTTGCCTCTCTGGATGTTGTTTGTTGCTATATTCGTGGGAACAAATGGGGAAACATACTACAATACAGCGTCGCTTGTGTCATGCATTCATAACTTCCCAGAAAGCCGAGGTCCTGTGGTGGGAATCCTGAAAGGGTTTTCTGGCTTGAGTGGAGCAATCTTGACTCAGGTTTATTTGATGTTCAACCCTTCT---------...CATGATTCTTCGGTTATTCTCATGGTTGCTCTTGGACCACCAGTCGTGGTTCTTGCTCTACTATTTATTGTTAGACCCGTGGAAAGAAGTTGC------------AGAACGAACTTGCGATCTGATGATTTAAGATTCCTGGCTATTTACGGTTTCTGTGTTGTCCTTGCGGTATATTTACTAGGATTGTTGGTACTTCAGAGTGTTTTTGATATGACTCAAACGATTATCACAACCTCTGGAGCCATCCTTGTC...ATTTTCATGGTTGTTCCAGTTCTTGTCCCTTTT
TRN  10010101100011000
NAM  O81121_ARATH/16-263
ASQ  RWLVFVAAMWIQSCAGIGYLFG.SISPVIKSSLNYNQKQLSRLGVAKDLGDSVGFLAGTLSEILPLWAALLVGSVQNLVGYGWVWLIVTGRAPILPLWAMCILIFVGNNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLGGAILSQVYTMIHSS---.DRASLIFMVAVAPSVVVVPLMFFIRPVGG-----HRQIRSSDATSFTVIYAVCILLAAYLMAVMLVEDFIDLSHSIIIAFTVVLF.AILLVPIFIPI
DSQ  AGATGGCTAGTGTTTGTTGCGGCCATGTGGATTCAGTCTTGCGCTGGCATCGGTTACTTGTTCGGC...AGCATCTCTCCTGTCATCAAGAGCTCCCTCAACTACAACCAGAAACAGCTCTCCAGGCTCGGTGTCGCCAAAGATCTCGGCGATAGTGTCGGCTTCCTCGCTGGTACTCTCTCCGAGATCTTGCCTCTCTGGGCCGCTCTTCTCGTCGGCTCTGTCCAGAACCTTGTCGGCTATGGCTGGGTTTGGCTTATCGTCACCGGTCGTGCTCCCATTCTTCCTTTATGGGCTATGTGTATCCTCATTTTTGTTGGGAACAACGGGGAGACCTACTTCAACACCGCTGCATTAGTTTCTGGTGTTCAGAACTTTCCCAAGAGCCGTGGTCCTGTCGTCGGTATCCTCAAGGGGTTTGCTGGCCTCGGCGGTGCCATCCTCTCCCAGGTATACACAATGATCCACTCCTCT---------...GACCGTGCATCCCTCATCTTCATGGTTGCTGTTGCCCCTTCAGTTGTTGTTGTTCCTCTCATGTTCTTCATCAGACCCGTCGGTGGT---------------CACAGACAGATCCGTTCTTCTGATGCCACCAGCTTCACCGTCATCTATGCCGTCTGCATTCTACTTGCTGCCTATCTCATGGCAGTGATGCTTGTTGAAGATTTCATTGATCTTAGCCATTCAATCATCATTGCTTTCACCGTTGTCTTGTTT...GCCATTCTTCTTGTACCCATCTTCATACCAATC
TRN  10010101110011000
NAM  Q9SLF1_ARATH/14-260
ASQ  KWLGFVTAVWVQSISGNNYTFS.NYSGALKSLMNLNQLELNNLSVAKDVGKAFGILAGLASDRLPTPVILLIGCFEGLLGYGVQWLVVSRTIQPIPYWQMCIFLCMGGNSTTWMNTAVLVTCIRNFRRNRGPVSGILKGYVGLSTAIFTDLCTALFSN---.DPASFLVLLAVVPFAVCLTAVFFLREIPPAS---SAAEENEETRYFTIFNIVAVVVAVYLQSYDIIGIK---TGVFSVAFASILL.FLLASPIAIPF
DSQ  AAATGGCTTGGATTTGTAACAGCGGTTTGGGTTCAATCCATCTCCGGCAACAACTACACTTTTTCA...AACTACTCCGGTGCTCTTAAGTCTCTCATGAATCTCAACCAGCTCGAGCTCAACAACCTCTCTGTCGCTAAAGACGTCGGAAAAGCCTTTGGGATCCTGGCTGGCCTTGCCTCTGACCGTCTTCCCACTCCGGTCATCCTCCTTATTGGTTGCTTTGAAGGTCTTCTTGGTTATGGTGTACAATGGCTCGTTGTTAGCCGCACCATCCAACCAATCCCTTATTGGCAGATGTGTATATTCCTCTGTATGGGAGGGAACAGCACAACGTGGATGAACACGGCGGTTCTAGTGACTTGCATACGCAATTTTCGACGAAACCGTGGTCCGGTCTCCGGGATATTGAAAGGATATGTCGGTTTAAGCACAGCTATATTCACTGATCTCTGTACTGCTCTGTTCTCAAAC---------...GATCCGGCGTCGTTTTTGGTTTTACTAGCCGTGGTGCCTTTTGCCGTATGTCTCACGGCGGTTTTCTTCCTCCGTGAGATCCCACCAGCATCT---------TCCGCAGCTGAGGAGAACGAAGAGACTCGTTACTTTACCATATTCAACATTGTGGCCGTTGTTGTCGCCGTGTATCTTCAGTCTTACGACATCATTGGAATCAAA---------ACTGGAGTGTTCTCTGTCGCTTTCGCTTCTATACTTCTC...TTCCTCTTGGCTTCTCCAATAGCCATTCCTTTC
TRN  10010101100011000
NAM  Q9M8M1_ARATH/13-260
ASQ  PWVGLAAAAWVQVSAGSGSTFP.LYSSALKSVLGFSQQQVTILGVACDLGENMGLLPGYASNKLPPWSMLLIGASSCFLGFGVLWLSVSQIVLGLPFWLLFVALALATNSNSWFGTASLVTNMRNFPMSRGPVAGLLKGYIGISGAAFTVLFSMVLHH---.SAMDLLLFLTVGIPVICLTVMYFIRPC-----IPATGEDPSEPMYFAFLLVTSILFAAYLVVTTVLSEVFILPSILKYVLVAIMV.LLLLSPLAVPI
DSQ  CCGTGGGTGGGATTAGCGGCAGCCGCATGGGTTCAGGTCTCGGCGGGAAGTGGTTCGACGTTCCCG...CTTTACTCCTCCGCTCTCAAATCGGTTTTGGGTTTTAGCCAGCAGCAGGTCACGATCCTTGGCGTTGCTTGTGATTTGGGTGAAAACATGGGTCTTCTTCCTGGATACGCCAGTAACAAGCTTCCTCCATGGTCGATGCTTCTCATCGGAGCTTCCTCTTGTTTCCTCGGCTTCGGCGTTCTTTGGCTCTCCGTCAGCCAAATCGTTCTTGGCTTGCCTTTTTGGCTGCTTTTTGTAGCTCTAGCTTTAGCTACCAATAGCAACTCGTGGTTCGGTACAGCATCTCTTGTCACCAATATGAGGAATTTTCCTATGAGCCGAGGCCCTGTGGCTGGACTTCTCAAAGGTTATATTGGGATCAGTGGTGCAGCATTCACTGTCTTGTTCAGCATGGTGCTTCACCAT---------...TCAGCTATGGATCTGCTTCTGTTTCTTACGGTTGGTATTCCGGTTATATGCTTAACTGTGATGTATTTCATCCGCCCCTGT---------------ATTCCGGCTACTGGTGAAGACCCTTCTGAGCCCATGTATTTCGCTTTTCTGCTTGTCACTAGTATACTGTTTGCTGCTTATCTTGTTGTGACGACTGTTTTGAGTGAGGTGTTTATACTGCCCAGCATACTCAAATATGTTCTTGTGGCTATCATGGTG...TTACTTTTGTTGTCGCCTCTTGCGGTTCCCATC
TRN  10010101100011000
NAM  Q8H6R3_9ROSI/13-260
ASQ  PWVGLAAAVWVEIAAGNAYNFP.LYSPALKSVMGYNQQQLTILGVANDIGESVGLLPGIACNKFPPWAVLLVGVVLCFLGYGVIWLTVSQTITGLPYWVLWIALVVATNSNAWFGTAVLVTNMRNFPLSRGTVAGILKGYAGIAAAIYTVLYNMVLQN---.SATTLLLFLALGIPLICLVTTYFIRAC-----TPASGEDSSEHGHFVFTQAASVFLAIYVVAISITSDYVSLSDALSYILVAIMV.VFMLSPLAIPV
DSQ  CCATGGGTGGGCTTGGCAGCAGCTGTGTGGGTGGAGATAGCAGCTGGGAATGCTTACAACTTCCCT...TTGTACTCGCCCGCATTAAAATCAGTTATGGGTTATAATCAGCAACAGCTCACAATATTGGGTGTCGCCAATGATATTGGAGAGAGTGTGGGACTGCTACCTGGTATTGCTTGCAACAAGTTCCCCCCTTGGGCTGTGCTTCTTGTCGGTGTTGTGCTTTGTTTCTTGGGTTATGGTGTTATTTGGCTTACTGTTAGCCAGACTATCACTGGCCTGCCTTATTGGGTGTTATGGATTGCACTTGTTGTTGCTACTAATAGCAATGCATGGTTTGGAACAGCAGTGCTAGTAACCAACATGAGGAATTTTCCCCTCAGTAGAGGTACTGTTGCTGGCATCCTCAAAGGTTATGCTGGGATTGCTGCTGCAATATATACAGTGTTATACAATATGGTGCTTCAGAAT---------...TCTGCAACAACACTCCTGCTGTTCCTGGCACTTGGGATTCCTTTAATCTGCTTAGTCACAACATACTTCATCCGGGCATGT---------------ACACCAGCTTCTGGAGAAGACTCTTCAGAGCATGGTCATTTTGTTTTCACCCAAGCTGCAAGCGTTTTTCTTGCTATCTATGTTGTTGCAATTTCAATAACAAGCGATTATGTTTCTCTAAGCGATGCTCTTTCCTACATATTAGTTGCCATAATGGTT...GTATTTATGCTGTCTCCATTGGCAATTCCTGTC
TRN  10010101100011000
NAM  Q8H613_ORYSA/14-261
ASQ  PWVGLGAAVWVQVAGGASSTFA.LYSHALKVALAADQRRLALLGVACDVGENLGLLPGVLCNRLHPALLLLVGAAACLLGYGSTWLAVSASGPALPYWLIWFALCLAANSGAWLGTAVLVTNMRNFPLSRGAVAGILKGYAGLSAAVYTVIYTGVLHD---.SASNFLLFVTLGVPVVCLVTMYFVRPCE-----PSLVENSSEQVHFLFTQLSSVLLGVYLVAATILDHFVTLTDAVNYVLLVIMV.LVLFVPLTVPL
DSQ  CCGTGGGTGGGGCTAGGGGCGGCGGTGTGGGTGCAGGTGGCGGGCGGAGCCAGCTCCACCTTCGCG...CTCTACTCCCACGCCCTCAAGGTCGCGCTCGCCGCCGACCAGCGCCGCCTCGCGCTGCTCGGGGTCGCCTGCGACGTCGGGGAGAACCTCGGCCTCCTCCCGGGCGTCCTCTGCAACCGCCTCCACCCCGCCCTGCTGCTCCTCGTCGGCGCCGCCGCATGCCTCCTCGGCTACGGCTCCACCTGGCTCGCCGTCTCCGCCTCCGGCCCCGCGCTCCCCTACTGGCTGATATGGTTTGCCTTATGCCTTGCTGCAAACAGTGGTGCATGGTTGGGGACCGCTGTTTTGGTAACCAATATGAGGAATTTCCCACTCAGTAGAGGTGCCGTCGCTGGCATCCTTAAAGGGTACGCTGGTTTAAGTGCTGCTGTGTACACTGTAATATACACCGGAGTACTTCATGAT---------...TCAGCTTCAAACTTTCTGCTTTTTGTCACCCTGGGAGTTCCTGTTGTGTGCCTTGTGACAATGTACTTCGTGCGGCCTTGTGAA---------------CCCTCCCTTGTGGAGAACTCTTCGGAGCAAGTGCATTTTCTGTTCACACAACTCTCCAGTGTTCTTCTAGGGGTTTATCTTGTTGCAGCCACGATATTGGACCATTTCGTAACTCTTACTGATGCTGTGAACTATGTTCTGCTTGTCATCATGGTC...CTTGTCCTCTTTGTTCCACTTACAGTACCCTTG
TRN  10010101100011000
NAM  Q9SS92_ARATH/41-290
ASQ  RWTVLVAAIWIQAFTGTNFDFS.AYSSDMKSSMGVSQSRLNYMAVASDLGKALGWSSGFAIAYFPVSGVLFAAAAMGLVGYGVQWLSIADVID-LPYSLVLVCCSLAGLSICWFNTVSFILCIRHFKANHSLALSLVVSFNGISAALYTLGHEAISGKS-SaSSDIYLLLNSLIPLIVSVLALWPVLTNPNSSET-DTTRTHDETRIFVVFNVLALVTCFYLLLPS--SGTYLASSPRWHFLGAI--.FLLLFPLCVPF
DSQ  AGATGGACGGTGTTGGTGGCCGCTATCTGGATTCAAGCATTCACCGGCACGAACTTCGATTTCTCT...GCCTACTCTTCCGACATGAAGTCTTCCATGGGGGTTTCTCAATCTCGGCTTAACTACATGGCGGTTGCTTCAGATTTGGGTAAAGCATTGGGTTGGTCTTCTGGTTTCGCCATTGCCTATTTCCCTGTCTCCGGCGTGCTTTTCGCTGCCGCCGCAATGGGACTCGTCGGTTACGGTGTCCAGTGGTTATCCATCGCCGATGTGATCGAT---CTACCTTACTCTCTGGTTCTGGTTTGCTGCTCCTTAGCCGGGTTAAGCATCTGCTGGTTCAACACCGTCAGCTTCATCCTCTGCATTCGACATTTCAAAGCGAACCACTCGTTGGCCCTGTCTCTCGTTGTGAGTTTCAACGGAATCAGTGCCGCGTTGTACACGCTTGGCCATGAAGCCATTAGTGGGAAATCA---TCGgcaAGCTCTGATATTTACCTTCTCCTTAACTCTCTCATCCCTCTGATCGTCTCTGTTTTAGCCCTTTGGCCGGTTCTTACTAACCCTAATTCCTCTGAAACC---GATACTACGCGAACGCATGACGAAACCAGAATCTTCGTAGTCTTCAATGTCTTAGCCTTAGTTACATGCTTTTACCTTCTCTTGCCTTCC------TCAGGCACCTACTTAGCCTCATCACCTCGTTGGCATTTCCTCGGAGCTATT------...TTCCTTCTCCTTTTCCCATTGTGCGTCCCGTTT
TRN  10010101100011000
NAM  Q9C862_ARATH/7-251
ASQ  KWTVLVAAIWIQASTGTNFDFS.AYSSHLKSVLGISQVRLNYLAVASDLGKAFGWSSGIALGYFPLSVVLFAAAAMGFVGYGVQWLVITNIIT-LPYSLVFLCCLLAGLSICWFNTACFILCIRHFPNNRALALSLTVSFNGISAALYSLAFNAINPSS-S.--NLYLLLNSLVPLVVSFAALYPVLTKPSLDTTPDYDSRRHDSHVFTILNVLAVITSFHLLL-----SSSSTSSARLNFIGAV--.VLLVFPLCAPL
DSQ  AAATGGACTGTTCTTGTGGCAGCGATCTGGATCCAAGCATCGACGGGAACCAACTTCGATTTCTCA...GCTTACTCTTCCCATCTCAAATCAGTTCTCGGAATTTCTCAGGTGAGGTTAAATTACCTCGCCGTGGCTTCTGATTTGGGGAAAGCGTTTGGATGGTCGTCTGGGATTGCTTTAGGTTATTTCCCTCTCTCCGTCGTTCTTTTCGCTGCGGCGGCTATGGGATTTGTTGGTTACGGTGTTCAGTGGCTAGTCATCACCAACATCATCACT---TTGCCTTATTCTCTGGTGTTTCTCTGCTGCTTGTTAGCTGGATTAAGTATCTGTTGGTTCAACACAGCATGTTTCATCCTCTGCATTCGTCATTTCCCGAACAATCGTGCTCTCGCCTTATCTTTAACGGTAAGCTTCAATGGAATCAGTGCAGCATTGTACTCCCTTGCTTTCAATGCAATTAACCCGTCGTCG---TCC...------AATCTATACCTTCTGCTGAACTCTCTGGTTCCCCTTGTTGTTTCCTTTGCTGCTCTTTACCCAGTTCTTACTAAACCGTCTCTAGATACTACTCCGGACTATGATTCCCGCAGACATGACTCCCATGTGTTTACCATTTTGAATGTTTTAGCTGTCATTACGAGTTTCCACCTTCTCCTA---------------TCTAGTTCCAGTACTTCATCAGCGCGTTTGAATTTCATTGGAGCTGTC------...GTCCTTCTGGTTTTCCCCTTGTGTGCTCCTCTT
TRN  10010101100011000
NAM  Q8H132_ARATH/7-253
ASQ  KWMILVATIWIQAFTGTNFDFS.AYSSDLKSVLGISQVQLNYLAVASDLGKVFGWSSGLALMYFPLWTVLFAAAFMGFVGYGVQWLVITHFIS-LPYIMVFLCCLLAGLSICWFNTVCFVLCISNFPANRSLALSLTVSFNGVSAALYTLAYNAINPTS-P.--ELYLLLNALIPLIVSFTAIIPILRQPPFEPLPPDGVRR-DSLMFLLLNILAALNGVYLLLFG--SNSSDLTSARLLFGGAI--.LLLVFPLCIPG
DSQ  AAATGGATGATACTGGTGGCGACGATATGGATTCAAGCTTTCACCGGGACGAATTTCGATTTCTCA...GCTTACTCGTCAGATTTGAAATCGGTTCTAGGGATTTCACAGGTGCAGCTAAACTACCTCGCCGTGGCTTCGGATCTCGGAAAAGTATTCGGATGGTCGTCGGGACTAGCGCTTATGTATTTCCCGCTTTGGACGGTGCTTTTCGCGGCGGCGTTTATGGGATTCGTCGGTTATGGAGTTCAGTGGCTTGTCATCACTCATTTCATCTCT---TTGCCTTATATCATGGTGTTTCTCTGTTGCTTACTTGCTGGTTTAAGTATCTGTTGGTTCAACACTGTCTGCTTTGTGCTCTGCATTAGTAACTTCCCTGCAAACAGATCACTTGCTCTTTCCCTCACAGTGAGTTTCAATGGTGTAAGCGCTGCTTTATATACTCTTGCTTACAACGCAATCAATCCAACTTCT---CCA...------GAGCTATATCTTCTTTTGAACGCTCTTATACCGCTCATTGTCTCTTTCACTGCTATCATCCCGATTCTTCGTCAACCGCCTTTTGAGCCTCTTCCACCAGATGGAGTTCGTCGT---GACTCTCTCATGTTTCTATTGCTCAACATACTCGCTGCTTTAAACGGTGTTTATCTCCTTCTCTTTGGA------TCAAACTCCTCTGATTTAACCTCTGCTCGTCTACTCTTTGGTGGAGCAATC------...CTCCTCTTGGTATTCCCTTTATGTATTCCCGGT
TRN  10010101100011000
NAM  Q94D97_ORYSA/8-252
ASQ  HWLSLVGSIWLQTINGPNSDFP.VYSSQLKELKSISQVQLNFLAFASDAGKLFGWFSGVAALYLPLWVVAFVGAAFGLVGYGIQYMFLDSS--GLRYWHLFLLTALAGNGICWINTVSYLLCINNFASNSRVAVSLATSYLGLSAKVYTSLAETFPGLANS.KTKTYLLLNAVVPLFVTVMVAPSLRVFDL------KSAAASSDAAFLVMFAITLATGACAVVGSIGSTANGLSSKEHMISLGV--.-LLATPILIPV
DSQ  CATTGGCTGAGCTTGGTAGGAAGTATCTGGCTCCAGACCATCAACGGCCCCAACTCCGACTTCCCG...GTGTACTCGTCGCAGCTCAAGGAGCTCAAGAGCATCAGCCAGGTGCAGCTCAACTTCCTCGCCTTCGCGTCCGACGCGGGCAAGCTCTTCGGATGGTTCTCCGGGGTGGCGGCGCTGTACCTGCCACTTTGGGTCGTCGCGTTCGTCGGCGCCGCGTTCGGGCTCGTCGGCTATGGCATCCAGTACATGTTCTTGGACAGCTCC------GGCCTCCGGTACTGGCATCTCTTCCTGCTCACCGCGCTGGCCGGGAATGGCATCTGCTGGATCAACACCGTCTCCTACCTCCTCTGCATCAACAACTTCGCGTCGAACAGCCGCGTCGCGGTGAGCCTCGCCACCAGCTACCTCGGCCTCAGCGCCAAGGTGTACACCAGCCTGGCCGAGACGTTCCCGGGGCTGGCCAACTCC...AAGACGAAGACGTACCTCCTCCTCAATGCCGTCGTGCCGCTGTTCGTCACCGTCATGGTGGCGCCGTCCCTCAGGGTGTTCGACCTC------------------AAGAGCGCGGCGGCGAGCTCGGACGCGGCATTCCTCGTCATGTTCGCGATCACGCTCGCCACGGGCGCCTGCGCGGTGGTCGGCAGCATCGGCTCGACGGCGAACGGGCTGTCCTCCAAGGAGCACATGATCAGCCTCGGCGTG------...---CTGCTGGCCACCCCGATCCTCATCCCGGTG
TRN  10010101100011011
NAM  O22926_ARATH/7-235
ASQ  PWLSLVAILWLQSFNGTNLSFP.AYSSQLKELLKISQFKLNYLSFASDAGKVLGFISGIAAVYLPLPLVLLAGGSLGFAGYGLQYLSIIKKI------------------ICWINTACYIVAINSFPVNRQVAVGITASYQGLSGKIYTDMVHSFFHTSQReEASGYLLLNSLVPLVACLVTAPMLMRHGGD---KTMSYSKDVKVGFIVLFVLTIATGIYAVATSLV--------SVPAVLVLVGIaLFLLAPLAIPI
DSQ  CCGTGGTTGAGTCTAGTCGCTATTCTCTGGCTTCAATCTTTCAATGGCACCAACTTGAGTTTCCCA...GCTTACTCTTCACAGCTTAAAGAGCTTCTCAAAATCTCCCAGTTTAAGCTAAATTATCTTTCTTTCGCCTCCGACGCTGGAAAAGTCCTAGGTTTTATCTCCGGTATCGCCGCCGTTTATCTTCCTCTCCCTCTTGTCCTTCTCGCCGGAGGTTCATTAGGGTTCGCCGGCTACGGTCTCCAGTATCTCTCCATCATCAAGAAGATT------------------------------------------------------ATCTGTTGGATCAACACAGCTTGTTACATCGTCGCAATCAATAGTTTTCCGGTGAACCGTCAAGTCGCCGTGGGGATCACGGCAAGTTATCAAGGTTTGAGTGGGAAAATCTACACCGACATGGTCCACTCTTTTTTTCACACGTCTCAACGTgaaGAAGCTTCGGGTTATCTCTTGCTCAACTCTCTTGTTCCATTGGTCGCTTGTCTCGTGACGGCTCCTATGTTGATGAGACACGGAGGAGAC---------AAAACGATGTCGTATTCTAAGGATGTTAAAGTTGGTTTTATCGTTTTGTTCGTCTTGACTATTGCTACGGGGATTTATGCGGTGGCTACGAGTCTTGTC------------------------TCGGTTCCTGCGGTTTTAGTACTTGTAGGCATTgctCTGTTTCTTCTTGCTCCTCTTGCTATACCAATT
TRN  10010101100011000
//