EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06734 - UL97)
FAM  PF06734
PID  UL97
DES  UL97
IPR  IPR010615
ANO  8
ALN  187
AID  0.39587
APH  ((Q91TK7_TUHV1/416-599:0.39894,Q67670_9BETA/353-535:0.61729):0.09130,(Q91B54_HCMV/461-644:0.12514,O71123_9BETA/363-547:0.17724):0.31066,((Q9DWA3_RCMVM/366-550:0.22507,Q83249_9BETA/396-581:0.27710):0.42680,(GCVK_HHV7J/302-483:0.15521,Q9WT04_9BETA/319-500:0.27768):0.99014):0.12256);
ATP  ((Q91TK7_TUHV1/416-599,Q67670_9BETA/353-535),(Q91B54_HCMV/461-644,O71123_9BETA/363-547),((Q9DWA3_RCMVM/366-550,Q83249_9BETA/396-581),(GCVK_HHV7J/302-483,Q9WT04_9BETA/319-500)));
ATL  4.19513
DNO  8
DLN  561
DID  0.49327
DPH  ((Q67670_9BETA/353-535:0.34801,((Q91B54_HCMV/461-644:0.13238,O71123_9BETA/363-547:0.22345):0.20866,((Q9DWA3_RCMVM/366-550:0.20407,Q83249_9BETA/396-581:0.20401):0.25783,Q91TK7_TUHV1/416-599:0.26170):0.06905):0.06429):0.69619,GCVK_HHV7J/302-483:0.17321,Q9WT04_9BETA/319-500:0.24698);
DTP  ((Q67670_9BETA/353-535,((Q91B54_HCMV/461-644,O71123_9BETA/363-547),((Q9DWA3_RCMVM/366-550,Q83249_9BETA/396-581),Q91TK7_TUHV1/416-599))),GCVK_HHV7J/302-483,Q9WT04_9BETA/319-500);
DTL  3.10256
RID  0.39587
RPH  ((Q91TK7_TUHV1/416-599:0.39894,Q67670_9BETA/353-535:0.61729):0.09130,(Q91B54_HCMV/461-644:0.12514,O71123_9BETA/363-547:0.17724):0.31066,((Q9DWA3_RCMVM/366-550:0.22507,Q83249_9BETA/396-581:0.27710):0.42680,(GCVK_HHV7J/302-483:0.15521,Q9WT04_9BETA/319-500:0.27768):0.99014):0.12256);
RTP  ((Q91TK7_TUHV1/416-599,Q67670_9BETA/353-535),(Q91B54_HCMV/461-644,O71123_9BETA/363-547),((Q9DWA3_RCMVM/366-550,Q83249_9BETA/396-581),(GCVK_HHV7J/302-483,Q9WT04_9BETA/319-500)));
RTL  4.19513
LNK  GCVK_HHV7J/302-483:P52344:U43400
LNK  O71123_9BETA/363-547:O71123:AF033185
LNK  Q67670_9BETA/353-535:Q67670:U26058
LNK  Q83249_9BETA/396-581:Q83249:U52860
LNK  Q91B54_HCMV/461-644:Q91B54:AF345350
LNK  Q91TK7_TUHV1/416-599:Q91TK7:AF281817
LNK  Q9DWA3_RCMVM/366-550:Q9DWA3:AF232689
LNK  Q9WT04_9BETA/319-500:Q9WT04:AB021506
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9WT04_9BETA/319-500
ASQ  NIFIN---HKKEIIFDAVLADYSLSEIHPE.YNGTCAIAKEYDRNLQLVPISRNKFCDMFNPGFRPLVANAMILVNVCEAFDGENNPLRHCNLDLCAFAQVVLLCVLRMTDKRGCREAQLYYEKRLFALANEACRLNPLRYPFAYRDACCKVLAEHVVLLG-LLFYRDVVDIYEKIYDFLDERGEFG
DSQ  AATATCTTTATAAAT---------CATAAAAAAGAGATAATCTTTGATGCCGTGTTGGCGGATTACAGCTTGTCCGAAATACATCCCGAG...TATAACGGCACGTGTGCTATTGCTAAAGAGTATGACAGAAATCTTCAACTTGTGCCAATCAGTCGTAACAAATTCTGTGACATGTTTAATCCTGGATTTCGACCACTTGTCGCCAATGCAATGATATTGGTCAATGTATGCGAGGCTTTTGATGGTGAAAATAATCCTCTTAGACACTGTAATTTGGATCTGTGCGCCTTTGCTCAGGTCGTATTATTGTGTGTCCTGAGAATGACAGATAAACGCGGATGCCGCGAAGCTCAGCTATACTACGAGAAAAGGTTGTTTGCGTTGGCTAACGAGGCCTGTCGATTGAATCCTCTTAGATATCCATTTGCTTACAGGGATGCTTGCTGTAAAGTATTGGCTGAGCATGTAGTGTTGCTAGGG---TTATTGTTTTACCGAGACGTGGTTGATATATATGAAAAAATATACGATTTTCTAGATGAAAGAGGGGAATTTGGG
TRN  10010101100011010
NAM  GCVK_HHV7J/302-483
ASQ  NILIH---HKEGIILEAVLADYSLAEVHPQ.YNGKCGILRQFDHRIQIVPKSYNKLCDMFNPGFRPMIAHKIILVEVYAEFDGKGNPVRHCNLDLCALAQVFLLCVIRMLDERGCREAQKYYENRLFTYSNEACTLNPIKYPLEYKDACCKVLAEHLVLFG-ILFYREVVDMFENLYDFLHASGDLS
DSQ  AATATTTTGATACAC---------CACAAGGAAGGTATTATTTTGGAGGCTGTGTTAGCTGATTACAGTTTAGCTGAAGTACACCCACAG...TATAATGGAAAATGTGGAATACTAAGACAATTTGATCATAGGATCCAGATTGTGCCTAAAAGTTATAATAAATTGTGTGACATGTTTAATCCAGGTTTCAGACCCATGATAGCTCACAAAATAATTTTGGTCGAAGTTTATGCAGAATTTGATGGTAAGGGCAATCCAGTGAGACATTGTAATCTAGATCTTTGTGCACTAGCGCAAGTATTTTTATTATGTGTCATCAGAATGTTGGATGAACGCGGATGCCGTGAGGCGCAAAAATATTATGAAAATCGATTGTTCACGTACTCAAATGAAGCTTGTACTTTGAATCCAATCAAATACCCTTTAGAATATAAAGATGCTTGTTGCAAAGTTTTAGCTGAGCACTTAGTTTTATTTGGC---ATTCTTTTTTATCGTGAGGTGGTGGATATGTTTGAAAACTTGTATGACTTTCTGCACGCAAGTGGTGATTTAAGC
TRN  10010101100011000
NAM  Q67670_9BETA/353-535
ASQ  NCLIKGDPSAPYRIARAALCDYSLTEPHPM.YNRRCAVVLQETKTRAHVAAQSDKLCECYHPAFRPIILQARER-RADGYFPFEDW-VQFCVAEICALGMVVCFCLMRTLDWRGVPTVRRGERVPLFQATPLACDAMEKQDLAGYSSACLAIMARQLAYVGAILG-SRVSDTFERTKRFVKVQCGDV
DSQ  AACTGCCTGATCAAAGGTGACCCGTCCGCCCCGTATCGGATCGCGCGCGCCGCGCTGTGCGACTACAGCCTGACCGAGCCCCACCCGATG...TACAATCGCAGGTGCGCCGTGGTCCTCCAGGAGACCAAGACGCGCGCGCATGTTGCCGCACAGTCAGATAAGCTGTGCGAGTGCTACCATCCCGCGTTCAGACCCATCATCCTGCAGGCACGTGAGCGC---CGAGCCGACGGCTATTTTCCGTTCGAGGACTGG---GTCCAGTTCTGCGTCGCCGAGATCTGCGCGCTGGGCATGGTGGTGTGTTTCTGTCTCATGAGGACCTTGGACTGGCGCGGGGTGCCGACCGTCAGGCGCGGTGAGCGAGTCCCTCTGTTCCAGGCCACGCCGCTGGCCTGCGACGCCATGGAGAAGCAGGATCTGGCCGGGTACTCCAGCGCCTGTCTGGCCATCATGGCCAGGCAGCTGGCCTACGTCGGAGCGATACTCGGG---TCCCGCGTCTCGGATACGTTCGAGCGCACCAAACGTTTCGTGAAGGTTCAGTGCGGTGACGTA
TRN  10010101100011001
NAM  Q91TK7_TUHV1/416-599
ASQ  NILVVPSRTCPGVLEHAVLCDYSLSEPHSD.FNRRCVVVFEQTKTARVLEDSRQRICECYHPAFRPVPLQRIVVINPHATFPVGAR-NRYSVAELCALGNVALFCLARLLDERGEDFVRYSCENALFRVAGSACRAMEADDLRSYSDRCLRILAHQLAYIHAVLG-DMASGIVTRTQRYVQVQCDPI
DSQ  AACATCCTGGTCGTGCCGTCCCGGACCTGCCCGGGGGTGCTGGAGCACGCCGTGCTCTGCGACTACAGCCTGTCCGAGCCGCACTCGGAC...TTCAACCGGCGCTGCGTGGTCGTCTTCGAGCAGACCAAGACCGCCCGGGTGCTGGAGGACAGCCGGCAGCGGATCTGCGAGTGCTACCACCCGGCGTTCCGGCCGGTGCCGCTGCAGCGCATCGTGGTCATCAATCCGCACGCCACCTTCCCGGTCGGCGCGCGC---AACCGCTATTCCGTCGCCGAGCTCTGCGCGCTGGGGAACGTGGCGCTGTTCTGTCTCGCCCGCCTCCTGGACGAGCGCGGGGAGGATTTCGTCCGCTACAGCTGCGAGAACGCCCTGTTTCGGGTGGCCGGCTCGGCCTGCCGCGCGATGGAGGCCGACGACCTGCGGAGCTACTCGGACCGGTGCCTGCGCATCCTGGCGCACCAGCTGGCCTACATCCACGCCGTGCTGGGC---GACATGGCGAGCGGGATCGTGACCCGGACCCAGCGCTACGTCCAGGTGCAGTGCGATCCTATT
TRN  11011111101111111
NAM  O71123_9BETA/363-547
ASQ  NVLINVNPHYHSEILHVALCDYSLSEPYPV.CNDRCVVVFQETGTARRIPNCTHRLRECYHPAFRPLPLQKLMICNPHARFPVSNSPRRFCMIELAALGNVLAFCLVRLLDRRGIEGVHNGPESLLFKHAATACHALENNRLTACSDACLLIMAAQLSYHAGLLG-DDGLAVVSQTVGFVEAKMSSC
DSQ  AATGTGCTGATCAATGTCAACCCGCACTACCACAGCGAGATTCTCCATGTAGCGCTCTGCGACTACAGCCTCAGTGAGCCTTATCCCGTG...TGCAACGACCGTTGCGTGGTGGTGTTTCAAGAAACCGGTACGGCTCGGCGCATCCCCAACTGTACGCATCGGTTGCGCGAGTGCTATCACCCTGCCTTTCGACCCCTCCCTCTGCAAAAACTGATGATCTGCAATCCCCATGCACGTTTTCCCGTTAGCAATAGTCCGCGGCGCTTTTGTATGATCGAACTGGCCGCTCTGGGGAACGTGTTGGCCTTTTGCTTGGTACGACTGTTGGATCGCCGGGGAATAGAGGGTGTTCACAATGGCCCTGAGTCGCTGCTGTTCAAACACGCCGCGACTGCCTGTCACGCGTTGGAAAACAACCGCCTGACGGCTTGCTCCGACGCCTGTTTACTCATTATGGCCGCGCAGCTGTCTTATCACGCCGGCCTGTTGGGC---GACGACGGCCTTGCCGTCGTGAGCCAGACGGTTGGCTTTGTGGAAGCCAAGATGTCGTCCTGT
TRN  10010101100011010
NAM  Q91B54_HCMV/461-644
ASQ  NVLIDVNPHNPSEIVRAALCDYSLSEPYPD.YNERCVAVFQETGTARRIPNCSHRLRECYHPAFRPMPLQKLLICDPHARFPVAGL-RRYCMSELSALGNVLGFCLMRLLDRRGLDEVRMGTEALLFKHAGAACRALENGKLTHCSDACLLILAAQMSYGACLLG-EHGAALVSHTLRFVEAKMSSC
DSQ  AACGTGCTCATCGACGTGAACCCGCACAACCCCAGCGAGATCGTGCGCGCCGCGCTGTGCGATTACAGCCTCAGCGAGCCCTATCCGGAT...TACAACGAGCGCTGTGTGGCCGTCTTTCAGGAGACGGGCACGGCGCGCCGCATCCCCAACTGCTCGCACCGTCTGCGCGAATGTTACCACCCTGCTTTCCGACCCATGCCGCTGCAGAAGCTGCTCATCTGCGACCCGCACGCGCGTTTCCCCGTAGCCGGCCTA---CGGCGTTATTGCATGTCGGAGCTGTCGGCGCTGGGTAACGTGCTGGGCTTTTGCCTCATGCGGCTGTTGGACCGGCGCGGTCTGGACGAGGTGCGCATGGGCACGGAGGCGTTGCTCTTTAAGCACGCCGGCGCGGCCTGCCGCGCGTTGGAGAACGGCAAGCTCACGCACTGCTCCGACGCCTGTCTGCTCATTCTGGCGGCGCAAATGAGCTACGGCGCCTGTCTCCTGGGC---GAGCATGGCGCCGCGCTGGTGTCGCACACGCTGCGCTTTGTGGAGGCCAAGATGTCCTCGTGT
TRN  11011111101111111
NAM  Q83249_9BETA/396-581
ASQ  NVLINYDRADDRQIARAVICDFSLSQCHTEgTTGHCVVVFQQTKTVRALPKSAYYLTDIYHPAFKPLMLQKLCAIEPRKQFPKPSA-NRFCVSDLCALGHVAAFCLVRVLDERGQLKVRSTSEDALFGVARKTCDALARHSVDEVANFCSLLITRQLAYTATLLGSDDMREPMARLCDYFETVSDKD
DSQ  AACGTGCTCATCAACTATGACCGCGCCGACGACAGGCAGATCGCGCGTGCGGTCATCTGCGATTTCAGCCTGTCGCAGTGTCACACCGAGggtACTACCGGACACTGCGTCGTGGTCTTCCAGCAGACCAAGACCGTCAGGGCGCTGCCCAAGAGCGCCTACTACCTCACGGACATCTACCATCCCGCCTTCAAGCCGCTCATGCTGCAGAAACTCTGCGCCATCGAGCCGCGCAAGCAGTTCCCCAAGCCCTCGGCG---AACCGCTTCTGCGTCTCGGACCTCTGCGCCCTGGGACACGTGGCCGCTTTCTGCCTGGTCAGGGTCCTGGACGAGCGCGGACAGCTCAAGGTCAGGAGCACCTCCGAGGACGCGCTCTTCGGCGTCGCGCGCAAGACCTGCGACGCCCTCGCCCGGCACTCGGTGGACGAGGTGGCGAACTTTTGCTCGCTGCTCATCACGCGCCAGCTGGCCTACACCGCCACCTTGCTGGGCAGCGACGACATGCGGGAGCCTATGGCGCGGTTGTGTGACTATTTCGAAACGGTTAGCGACAAGGAC
TRN  10010101100011011
NAM  Q9DWA3_RCMVM/366-550
ASQ  NILVQVDPEDGRRLRRAVLCDYSLAQYNGP.HDDRCVVVFQQTRTVRALQSSTYYLTDLYHPAFKPLPLQKLSCVEPRARFPHPSA-RRFCVTDLCALGSVVAFCLVRVLDDRGLPKVRATTENALFAVARKTCEALGRHDEDAVANWSSLLLTRQLAYAVSLLGVDEAREAVADLCHFFAANADHE
DSQ  AACATCCTCGTCCAGGTCGACCCCGAGGACGGGCGGCGTCTGCGGCGGGCGGTCCTCTGCGACTACAGCCTCGCGCAGTACAACGGGCCC...CACGACGATCGCTGCGTGGTGGTCTTCCAGCAGACCCGGACCGTGCGGGCGCTGCAGAGCAGCACCTACTACCTCACGGACCTGTACCATCCCGCGTTCAAGCCCCTGCCGCTCCAGAAGCTGTCGTGCGTCGAGCCGCGGGCGCGGTTTCCCCACCCGAGCGCC---CGGCGCTTCTGCGTCACGGACCTCTGCGCCCTGGGCAGCGTCGTCGCCTTCTGTCTCGTGCGGGTGCTCGACGACCGCGGCCTCCCCAAGGTCCGGGCCACGACCGAGAACGCGCTCTTCGCCGTCGCCCGGAAGACCTGCGAGGCCCTCGGACGACACGACGAGGACGCCGTCGCCAACTGGAGCTCGCTCCTGCTGACTCGGCAGCTGGCCTACGCCGTCTCCCTATTGGGCGTCGACGAGGCCCGGGAGGCCGTGGCCGACCTATGCCATTTCTTCGCCGCCAACGCGGATCACGAG
TRN  11011111101111111
//