EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06730 - DUF1208)
FAM  PF06730
PID  DUF1208
DES  Protein of unknown function (DUF1208)
IPR  IPR009602
ANO  3
ALN  271
AID  0.490863
APH  (Q9VK91_DROME/1-264:1.30983,Q8N8R1_HUMAN/1-261:0.16849,Q8BP22_MOUSE/70-334:0.12407);
ATP  (Q9VK91_DROME/1-264,Q8N8R1_HUMAN/1-261,Q8BP22_MOUSE/70-334);
ATL  1.60239
DNO  3
DLN  813
DID  0.537101
DPH  (Q9VK91_DROME/1-264:0.98217,Q8N8R1_HUMAN/1-261:0.16327,Q8BP22_MOUSE/70-334:0.12780);
DTP  (Q9VK91_DROME/1-264,Q8N8R1_HUMAN/1-261,Q8BP22_MOUSE/70-334);
DTL  1.27324
RID  0.490863
RPH  (Q9VK91_DROME/1-264:1.30983,Q8N8R1_HUMAN/1-261:0.16849,Q8BP22_MOUSE/70-334:0.12407);
RTP  (Q9VK91_DROME/1-264,Q8N8R1_HUMAN/1-261,Q8BP22_MOUSE/70-334);
RTL  1.60239
LNK  Q8BP22_MOUSE/70-334:Q8BP22:AK078438
LNK  Q8N8R1_HUMAN/1-261:Q8N8R1:AK096298
LNK  Q9VK91_DROME/1-264:Q9VK91:AE003636
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9VK91_DROME/1-264
ASQ  MFRRGKLSFLNTKDDRVKIINERINITERHLMEMCSSFALVTRKMAKYRDSFDELAKSVKSYADDEEINESLCQGLKSFTNAVTIMGDYMDINVHRLEHKIVNELAQFEQLCKSTRDNLRLAVIARDKEVLRQRQMLELKSKFSANN---SAADSELFKAKMEVQRTNKEIDDIIGNFEQRKLRDLKQIISDFILIAMKQHTKALEILSASYYDIGTIDERDDFIEFQKLM----KTKEELASRKTALKKGLRSQSMDSLEHEHLVSPLKR
DSQ  ATGTTTCGTCGTGGAAAACTATCCTTTCTAAACACCAAAGATGACCGTGTTAAAATAATAAACGAGCGCATAAACATAACAGAAAGGCATCTAATGGAGATGTGCTCTTCGTTTGCTTTGGTAACGCGGAAAATGGCCAAATATCGGGACTCCTTTGATGAGTTGGCCAAGAGTGTGAAGAGCTACGCCGACGACGAGGAAATCAACGAGAGTCTCTGTCAGGGACTGAAGAGCTTCACCAACGCGGTTACCATAATGGGTGATTACATGGACATCAATGTACACCGATTGGAACACAAGATTGTCAACGAGTTGGCGCAATTCGAGCAGCTTTGCAAGTCCACAAGGGACAATCTTCGACTGGCTGTCATAGCGCGGGATAAGGAGGTACTACGTCAGCGCCAGATGCTTGAGCTCAAGTCAAAGTTTTCTGCGAACAAT---------AGTGCCGCCGATTCGGAGCTGTTTAAGGCCAAAATGGAGGTGCAGCGCACAAACAAGGAGATAGACGACATTATTGGCAACTTCGAGCAGCGGAAGTTGCGCGACTTAAAGCAGATAATCAGCGATTTTATACTGATCGCCATGAAACAGCACACCAAGGCATTGGAGATACTCAGCGCAAGCTACTATGATATTGGAACCATTGATGAGCGCGACGATTTCATTGAGTTTCAGAAACTCATG------------AAGACCAAAGAAGAGCTGGCTTCCAGGAAAACTGCACTCAAAAAGGGACTGCGCTCCCAGTCGATGGATAGCTTGGAGCACGAGCACCTGGTCAGTCCGCTCAAGAGG
TRN  10010101100011000
NAM  Q8N8R1_HUMAN/1-261
ASQ  MMRRT----LENRNAQTKQLQTAVSNVEKHFGELCQIFAAYVRKTARLRDKADLLVNEINAYAATETPHLKL--GLMNFADEFAKLQDYRQAEVERLEAKVVEPLKTYGTIVKMKRDDLKATLTARNREAKQLTQLERTRQRNPSDRHVISQAETGLQRAAMDASRTSRHLEETINNFERQKMKDIKTIFSEFITIEMLFHGKALEVYTAAYQNIQNIDEDEDLERWSFAM----LPRLVLNSWGSSDPPALASQSVRFSEILCMHQIIHL
DSQ  ATGATGAGGCGCACC------------CTGGAAAACCGGAACGCTCAAACGAAACAACTGCAAACAGCTGTCTCAAATGTGGAGAAGCATTTTGGAGAACTGTGCCAAATCTTCGCTGCCTATGTGCGGAAAACTGCCAGGCTGAGAGACAAAGCAGACCTCCTGGTGAATGAAATTAACGCGTATGCTGCTACAGAGACCCCGCATTTAAAGCTG------GGCCTGATGAACTTTGCAGATGAGTTTGCCAAACTTCAGGACTATCGACAAGCAGAGGTTGAAAGACTTGAAGCCAAAGTAGTTGAACCCTTGAAAACTTATGGGACCATTGTGAAAATGAAACGGGATGACCTCAAAGCAACACTCACAGCAAGGAATCGAGAAGCTAAGCAATTAACTCAGTTAGAAAGAACACGTCAGCGAAACCCATCTGATCGACATGTTATTTCACAGGCAGAAACGGGATTACAGAGAGCTGCAATGGATGCTAGCCGAACAAGTCGTCATCTGGAGGAAACTATTAACAACTTTGAAAGGCAGAAAATGAAGGATATAAAGACTATATTTTCTGAATTTATCACAATCGAAATGTTATTTCACGGCAAAGCTTTAGAGGTCTACACTGCTGCCTACCAGAATATACAAAACATTGATGAAGATGAAGATTTAGAGAGATGGAGTTTCGCCATG------------TTGCCCAGGCTGGTCTTGAACTCCTGGGGCTCAAGCGATCCGCCTGCGTTGGCCTCCCAAAGTGTCAGGTTTTCCGAAATTCTCTGTATGCACCAGATTATTCATCTC
TRN  10010101100011000
NAM  Q8BP22_MOUSE/70-334
ASQ  MLRRN----LDERDAQTKQLQDAVTNVEKHFGELCQIFAAYVRKTARLRDKADLLVNEINLYASTETPNLKQ--GLKDFADEFAKLQDYRQAEVERLEAKVVEPLKAYGTIVKMKRDDLKATLTARNREAKQLSQLERTRQRNPSDRHVISQAETELQRATIDATRTSRHLEETIDNFEKQKIKDIKNILSEFITIEMLFHGKALEVFTAAYQNIQNIDEDEDLEVFRNSLYLSDYPSRLDIVRANSKSPLQRSLSTKCTSGTGQISTCRT
DSQ  ATGTTGAGGCGCAAT------------CTGGATGAGCGAGATGCTCAAACAAAACAACTGCAGGATGCTGTCACAAATGTGGAGAAGCATTTTGGAGAGCTTTGCCAAATCTTTGCTGCTTATGTACGGAAAACTGCCAGGCTTCGAGACAAAGCCGACCTCCTAGTGAACGAAATCAACCTGTATGCCTCTACCGAGACACCAAATTTAAAGCAG------GGTCTGAAAGACTTTGCTGATGAGTTTGCCAAACTTCAAGATTATCGCCAGGCAGAGGTTGAAAGACTTGAAGCCAAAGTAGTTGAACCTTTGAAAGCTTATGGGACCATTGTAAAGATGAAGCGAGATGATCTCAAAGCAACATTAACAGCAAGGAATCGAGAAGCCAAACAGCTATCTCAGTTAGAAAGGACACGCCAGCGAAACCCATCTGATCGACATGTAATTTCGCAGGCAGAAACTGAATTACAGAGAGCCACGATTGATGCTACCCGCACAAGTCGTCATTTGGAGGAAACTATTGACAATTTTGAAAAGCAGAAAATAAAGGACATAAAGAACATATTATCTGAGTTCATCACAATTGAAATGTTATTTCATGGAAAAGCCTTAGAGGTCTTCACTGCTGCCTACCAAAATATACAAAACATTGATGAGGATGAAGACCTAGAGGTTTTCCGAAATTCTCTGTATCTATCAGATTATCCATCTCGCTTAGATATTGTAAGAGCAAATTCAAAGTCACCTCTTCAGAGATCATTGTCAACTAAGTGCACATCTGGAACTGGACAGATATCCACCTGCCGAACA
TRN  10010101100011000
//