EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06707 - DUF1194)
FAM  PF06707
PID  DUF1194
DES  Protein of unknown function (DUF1194)
IPR  IPR010607
ANO  6
ALN  252
AID  0.440012
APH  (Q98G05_RHILO/26-257:0.40114,(Q98HK0_RHILO/111-350:0.69251,((Q89RX1_BRAJA/44-280:0.21550,Q89Y61_BRAJA/85-324:0.26474):0.27190,Q98KZ1_RHILO/92-336:0.43237):0.14540):0.07860,Q8YM96_ANASP/32-255:0.97547);
ATP  (Q98G05_RHILO/26-257,(Q98HK0_RHILO/111-350,((Q89RX1_BRAJA/44-280,Q89Y61_BRAJA/85-324),Q98KZ1_RHILO/92-336)),Q8YM96_ANASP/32-255);
ATL  3.47763
DNO  6
DLN  756
DID  0.524673
DPH  ((((Q98HK0_RHILO/111-350:0.38169,Q8YM96_ANASP/32-255:0.68757):0.11794,Q98G05_RHILO/26-257:0.27800):0.12842,Q98KZ1_RHILO/92-336:0.30221):0.14038,Q89RX1_BRAJA/44-280:0.13270,Q89Y61_BRAJA/85-324:0.24197);
DTP  ((((Q98HK0_RHILO/111-350,Q8YM96_ANASP/32-255),Q98G05_RHILO/26-257),Q98KZ1_RHILO/92-336),Q89RX1_BRAJA/44-280,Q89Y61_BRAJA/85-324);
DTL  2.41088
RID  0.440012
RPH  (Q98G05_RHILO/26-257:0.40114,(Q98HK0_RHILO/111-350:0.69251,((Q89RX1_BRAJA/44-280:0.21550,Q89Y61_BRAJA/85-324:0.26474):0.27190,Q98KZ1_RHILO/92-336:0.43237):0.14540):0.07860,Q8YM96_ANASP/32-255:0.97547);
RTP  (Q98G05_RHILO/26-257,(Q98HK0_RHILO/111-350,((Q89RX1_BRAJA/44-280,Q89Y61_BRAJA/85-324),Q98KZ1_RHILO/92-336)),Q8YM96_ANASP/32-255);
RTL  3.47763
LNK  Q89RX1_BRAJA/44-280:Q89RX1:BA000040
LNK  Q89Y61_BRAJA/85-324:Q89Y61:BA000040
LNK  Q8YM96_ANASP/32-255:Q8YM96:BA000019
LNK  Q98G05_RHILO/26-257:Q98G05:BA000012
LNK  Q98HK0_RHILO/111-350:Q98HK0:BA000012
LNK  Q98KZ1_RHILO/92-336:Q98KZ1:BA000012
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q98KZ1_RHILO/92-336
ASQ  ADEPVDVELVLAVDVSLSMSADELEIQRHGYAAALTHDNV-LQAIADGAHGKIAVTYVEWAGTTWQRVIVPWTVIANRADAERVVAQLSAQPPNSARRTSISGALEFGSDLFAESGYEGTKRVIDISGDGPNNQGAPVNLTRDGVVRQGI-VINGLPLMTRGGL.SGAYDV---NDLDRYYSDCVIGGPGAFMIPVNDWTQFPEAIRRKLVLELAGPASPQWAAEEADHPPVVLTQDKPAADC-QIGEKMWR
DSQ  GCGGATGAGCCGGTCGATGTCGAGCTCGTGCTGGCGGTCGACGTTTCGCTGTCGATGTCGGCGGACGAACTCGAGATCCAGCGTCATGGCTACGCGGCGGCGCTGACGCATGACAATGTG---CTGCAGGCGATCGCCGATGGCGCCCATGGCAAGATCGCCGTCACCTATGTCGAATGGGCCGGCACCACGTGGCAGCGCGTCATCGTGCCATGGACTGTCATCGCCAACCGTGCCGACGCGGAGCGGGTGGTCGCGCAATTGTCCGCGCAGCCGCCCAACAGCGCGCGGCGCACCTCGATCTCCGGCGCGCTGGAATTCGGCAGCGATCTGTTTGCCGAAAGCGGCTATGAGGGGACCAAGCGGGTCATCGACATTTCCGGCGACGGGCCCAACAACCAGGGCGCTCCGGTCAATCTCACCCGCGACGGCGTGGTCAGACAAGGCATC---GTCATCAACGGCCTGCCGCTGATGACCCGGGGTGGCCTT...TCCGGCGCCTACGACGTC---------AACGATCTTGACCGCTACTACAGCGACTGCGTCATCGGCGGCCCCGGCGCCTTCATGATCCCGGTCAATGACTGGACGCAATTTCCCGAAGCCATCCGCCGCAAGCTGGTGCTGGAGCTTGCCGGCCCGGCCTCACCGCAATGGGCGGCGGAGGAGGCGGATCATCCGCCGGTGGTGCTGACGCAGGACAAGCCCGCCGCCGACTGC---CAGATCGGCGAGAAAATGTGGCGC
TRN  10010101100011001
NAM  Q89Y61_BRAJA/85-324
ASQ  SRPAVDLELVIAVDISYSVQPDDLAAQREGYAKAIVSEEF-LRALRTGPVGKIALTYFEWSSTRDQDVIVPWRQIDGPEAAEAVAAEIMKAPIRRGSRTSISGAIKFAMPLFEQNPYRGARRIIDVAGDGPNNNGDPVATARDTAVQQGI-VITGLPVMINATP.PGQVDISHIDHIDWYYEDCVIGGPGSFVVPITDRENFKEAIRTKLALEVAGRTPDQSPPPSV--------DKKPRVLC-TIGEKLWQ
DSQ  AGCCGCCCCGCCGTGGACCTCGAGCTCGTGATCGCGGTCGACATTTCCTACTCGGTGCAGCCAGATGACCTGGCGGCTCAACGCGAAGGCTATGCCAAGGCCATCGTCTCGGAGGAGTTT---CTGCGGGCCTTGCGGACCGGCCCTGTCGGCAAGATCGCGCTGACCTACTTCGAATGGTCATCGACAAGGGATCAGGACGTCATCGTCCCCTGGCGGCAGATCGACGGACCGGAAGCGGCCGAGGCCGTCGCAGCTGAAATCATGAAGGCACCGATCCGCCGCGGTTCGCGCACGTCGATTTCGGGTGCGATCAAGTTCGCCATGCCGCTGTTCGAGCAGAACCCGTACCGGGGCGCGCGCCGCATCATCGACGTTGCGGGCGATGGCCCCAACAACAACGGCGATCCTGTCGCCACCGCGCGCGACACAGCAGTGCAGCAGGGCATC---GTCATCACCGGCCTGCCGGTCATGATCAATGCAACGCCT...CCTGGTCAGGTGGACATCAGCCATATCGACCATATCGATTGGTACTATGAGGATTGCGTGATCGGCGGTCCAGGTTCCTTCGTCGTGCCCATCACCGATCGCGAAAACTTCAAGGAGGCGATCCGGACCAAGCTGGCGCTCGAGGTCGCGGGCCGTACGCCGGATCAATCGCCGCCCCCCTCAGTG------------------------GACAAGAAGCCGCGGGTTCTCTGC---ACGATTGGTGAAAAACTCTGGCAG
TRN  10010101100011001
NAM  Q89RX1_BRAJA/44-280
ASQ  DAQTVDVELILAVDVSYSMDMDELAIQREGYAQAIQSKEF-LQALKMGPNGRIAVTYFEWAASTDQKIIIPWRLIDGPETADAVATEIMKTPIRRASRTSISGAITFAMPLFDEDPYRGLRRVIDISGDGPNNNGGPVTVARDAALEKGI-VINGLPIMVKEPS.YSTMDI---DNLDYYYEDCVIGGPGSFVITIKDREKFKEAIRTKLLMEVAGRVPERPVMRVA--------DKEPRVSC-LIGEKIWS
DSQ  GATGCGCAGACGGTCGATGTCGAGCTGATCCTCGCGGTCGACGTGTCCTACTCCATGGACATGGACGAGCTGGCGATCCAGCGCGAGGGCTACGCGCAGGCGATCCAGTCGAAAGAGTTT---CTCCAGGCGCTGAAGATGGGCCCGAACGGCCGGATTGCGGTGACCTATTTCGAGTGGGCCGCCTCGACCGACCAGAAGATCATCATTCCCTGGCGGCTGATCGACGGACCTGAGACCGCGGACGCGGTCGCCACCGAAATCATGAAGACGCCGATCCGGCGCGCCTCGCGCACCTCGATCTCCGGCGCGATCACGTTCGCGATGCCGCTGTTCGACGAGGATCCCTATCGGGGCTTGCGTCGCGTCATCGACATCTCCGGCGACGGCCCCAACAACAATGGCGGCCCGGTCACGGTGGCGCGCGACGCCGCGCTCGAGAAAGGCATC---GTCATCAACGGCCTGCCGATCATGGTCAAGGAGCCGTCC...TATTCGACCATGGATATC---------GACAATCTCGACTACTACTACGAGGATTGCGTCATCGGCGGTCCCGGCTCCTTCGTCATCACGATCAAGGACCGCGAGAAGTTCAAGGAAGCGATCCGCACCAAGCTCCTGATGGAGGTCGCAGGCCGCGTGCCCGAGCGTCCCGTGATGCGGGTCGCC------------------------GACAAGGAGCCGCGCGTCAGTTGC---CTGATCGGCGAGAAGATCTGGTCG
TRN  11011101101011011
NAM  Q98G05_RHILO/26-257
ASQ  GAPAVDVELVLAVDISLSMDEKEFALQRAGYVEALRHPDF-IQAVRSGNAGRIAIAYFEWAGTVRDDAVIDWQIIDSAQSANSFADKVAARPFRSFRGTSISTAIAFGTGLFGRTNFAGERSVIDISGDGPNNIGPPVTAMRDAATAKGI-VINGLPILINPSP.----TF---KHLDQYYAQCVIGGPGSFVLPIHTAAEFSTAIRRKLILEVSGIQGKASIIP---------VDADAPIDC-LQGERDRR
DSQ  GGTGCGCCAGCTGTCGACGTCGAGTTGGTGTTGGCGGTCGATATATCCCTGTCGATGGACGAGAAGGAATTCGCCCTGCAACGCGCCGGCTATGTCGAAGCTCTGCGCCATCCCGACTTC---ATCCAGGCCGTCCGGTCCGGCAATGCGGGCCGCATCGCGATTGCCTATTTCGAATGGGCCGGCACGGTGCGCGACGACGCGGTCATCGATTGGCAGATCATCGACAGCGCGCAAAGCGCCAACAGCTTTGCCGACAAGGTGGCGGCGCGCCCGTTCCGGAGTTTTCGCGGTACCTCGATTTCCACGGCAATTGCCTTCGGCACAGGGCTGTTCGGCAGGACGAATTTCGCTGGTGAGCGCAGCGTCATCGATATATCGGGCGATGGCCCCAACAATATCGGGCCGCCGGTCACCGCGATGCGCGATGCGGCAACCGCAAAAGGCATC---GTCATCAACGGCCTGCCGATCCTGATCAACCCATCGCCC...------------ACCTTC---------AAGCATCTTGACCAGTACTACGCGCAGTGCGTGATCGGCGGACCCGGTTCCTTCGTGTTGCCGATCCATACGGCCGCCGAATTTTCCACCGCCATCCGGCGCAAGCTGATCCTCGAGGTGAGCGGCATTCAGGGCAAGGCCAGCATCATCCCG---------------------------GTCGACGCGGACGCACCGATCGACTGC---CTGCAAGGCGAACGCGACAGGCGG
TRN  10010101100011011
NAM  Q98HK0_RHILO/111-350
ASQ  DLADVDLQLILAVDVSPSMSKVEQKVQRDGYVGAFRHADI-ARALKSGERGRIAVLYLEWAGPRQQTVVMPWTIVESLDDALILADRLAALPLTEGRGTSISGALSAAHALFAKSGLRSPRRVIDVSGDGPNNAGLPLQLVHDALTTGGV-TINGLAISLRAADtLDSFGP---HFIELYYESCVIGGSNAFVVTVENTADFANAIRKKLVNEIAGLSAKVQPATYR-------SHSRPVVDCDTIGETPGR
DSQ  GATCTGGCCGATGTCGATCTGCAGTTGATCCTTGCCGTGGACGTCTCGCCCTCGATGAGCAAAGTTGAGCAAAAAGTGCAACGCGACGGCTACGTCGGGGCCTTCCGCCACGCGGACATC---GCGAGGGCACTCAAGTCGGGAGAGCGGGGCAGAATCGCAGTGCTCTATCTGGAGTGGGCAGGGCCACGTCAGCAAACAGTCGTTATGCCGTGGACAATTGTCGAAAGCCTCGACGACGCTCTGATTTTGGCAGACAGGCTCGCGGCGCTGCCGTTGACTGAAGGGCGTGGAACGTCGATTTCCGGCGCGTTGTCGGCCGCGCATGCTCTGTTCGCGAAGAGTGGCTTGCGCAGTCCGCGCAGGGTTATTGACGTATCCGGCGACGGACCCAACAATGCCGGTCTACCGCTTCAACTGGTGCACGACGCACTCACAACCGGCGGCGTG---ACCATCAACGGACTGGCGATCTCACTGCGCGCAGCCGACacgCTCGACAGCTTTGGGCCG---------CACTTTATCGAACTGTATTACGAGAGTTGCGTCATTGGCGGTTCTAACGCCTTCGTTGTCACCGTCGAGAACACAGCCGACTTTGCGAACGCCATTCGCAAGAAGCTCGTGAATGAAATTGCCGGTTTGTCCGCTAAGGTGCAGCCTGCAACTTATCGG---------------------AGCCACTCACGACCGGTCGTCGATTGCGATACGATCGGAGAGACGCCTGGACGA
TRN  10010101100011001
NAM  Q8YM96_ANASP/32-255
ASQ  AATFVDTELSLLVDVSSSISTSEFNLQKQGYVDAFNNADLFNNFISKGNIGKIAVNLIYWSSATQQQQSVGWTLIDSVEASQNFANAINATTRPFGGGTVIGSAIDFATPLIFNNEFESNRQVIDVSGDGRSN-AVTTAAARDAALAAGVDAINGLVIGNS---.---------TSLFNFYNNNVKGGAGSFVLQANTFQDFADTVELKLRREIISEPPTTTP--------------EPATLIGLFGLGAFG
DSQ  GCTGCTACCTTTGTTGATACGGAGTTGTCTTTACTTGTTGACGTATCTAGTAGTATCAGTACTAGTGAATTCAACTTGCAAAAACAAGGCTATGTAGATGCTTTTAATAATGCTGATCTTTTCAACAACTTTATCTCAAAGGGAAATATCGGCAAGATTGCTGTTAACTTAATCTATTGGTCTAGTGCTACTCAGCAGCAACAGTCTGTAGGTTGGACACTGATTGATAGTGTGGAAGCGTCCCAAAACTTTGCGAATGCAATTAATGCCACAACTCGCCCTTTCGGTGGAGGTACTGTTATCGGATCGGCAATTGATTTTGCTACCCCTCTAATCTTTAATAATGAATTTGAAAGCAACCGTCAAGTGATTGACGTATCTGGTGACGGTAGAAGCAAC---GCAGTTACTACAGCAGCGGCCCGCGATGCTGCTTTAGCTGCTGGTGTTGATGCGATCAATGGTTTAGTCATTGGTAACAGT---------...---------------------------ACATCTCTATTCAACTTCTATAACAATAACGTCAAGGGCGGTGCTGGTTCTTTTGTTTTACAGGCCAATACTTTCCAAGATTTCGCTGACACAGTTGAACTGAAACTCAGAAGAGAAATTATTTCAGAGCCTCCTACAACAACTCCC------------------------------------------GAACCAGCTACGCTGATTGGTTTATTCGGTCTGGGTGCGTTTGGT
TRN  10010101100011000
//