EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06672 - DUF1175)
FAM  PF06672
PID  DUF1175
DES  Protein of unknown function (DUF1175)
IPR  IPR009558
ANO  3
ALN  211
AID  0.644571
APH  (Y8E0_PSEAE/6-212:0.23172,YFAT_ECOLI/1-207:0.16941,Q8XV01_RALSO/31-241:0.40836);
ATP  (Y8E0_PSEAE/6-212,YFAT_ECOLI/1-207,Q8XV01_RALSO/31-241);
ATL  0.80949
DNO  2
DLN  633
DID  0.661836
DPH  (Y8E0_PSEAE/6-212:0.05068,Q8XV01_RALSO/31-241:0.40231);
DTP  (Y8E0_PSEAE/6-212,Q8XV01_RALSO/31-241);
DTL  0.45299
RID  0.607143
RPH  (Y8E0_PSEAE/6-212:0.18843,Q8XV01_RALSO/31-241:0.38362);
RTP  (Y8E0_PSEAE/6-212,Q8XV01_RALSO/31-241);
RTL  0.57205
LNK  Q8XV01_RALSO/31-241:Q8XV01:AL646073
LNK  Y8E0_PSEAE/6-212:Q9HVT1:AE004862
LNK  YFAT_ECOLI/1-207:P76466:
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Y8E0_PSEAE/6-212
ASQ  AFGLALLLLASGVARGEPAVTLDPQQSQVFRAWFVRIAQEQLRQGPSPRWHQQDCAGLVRFAANEALKVHDGKWLRANGL----SNRYLPPELALSPEQRRLAQNWQQGGGQVGPYVNAIKLVQFNSRLVGRDLNQARPGDLMFYDQGDDQHLMIWMGRSIAYHTGSSTPTDNGMRSVSLQQLMTWKDTRWIPDESNPNFIGIYRLAFLSQ
DSQ  GCCTTCGGCCTGGCGCTGCTCCTGCTGGCCAGCGGCGTTGCCCGCGGCGAGCCCGCGGTAACGCTCGACCCGCAGCAATCGCAGGTATTCCGCGCCTGGTTCGTGCGCATCGCCCAGGAACAGTTGCGCCAAGGGCCGAGTCCGCGCTGGCACCAGCAGGACTGCGCCGGCCTGGTGCGCTTCGCCGCCAACGAGGCGCTGAAAGTCCACGATGGCAAGTGGCTGCGCGCCAACGGCCTG------------TCCAACCGCTACCTGCCCCCGGAGCTGGCGCTCAGTCCCGAGCAACGGCGCCTGGCGCAGAACTGGCAGCAGGGTGGCGGCCAGGTCGGGCCCTACGTGAATGCGATCAAGCTGGTGCAGTTCAACAGCCGGCTGGTCGGTCGCGACCTCAACCAGGCGCGCCCCGGCGACCTGATGTTCTACGACCAGGGCGACGACCAGCACCTGATGATCTGGATGGGCCGCTCCATCGCCTATCACACCGGCAGCAGCACCCCGACCGATAACGGCATGCGCTCGGTCAGCCTGCAACAACTCATGACATGGAAGGACACCCGATGGATCCCCGACGAATCCAATCCCAACTTTATCGGCATCTATCGGCTGGCTTTCCTCTCTCAA
TRN  11011101101011011
NAM  YFAT_ECOLI/1-207
ASQ  MRHGLLALICWLCCVVAHSEMLNVEQSGLFRAWFVRIAQEQLRQGPSPRWYQQDCAGLVRFAANETLKVHDSKWLKSNGL----SSQYLPPEMTLTPEQRQLAQNWNQGNGKTGPYVTAINLIQYNSQFIGQDINQALPGDMIFFDQGDAQHLMVWMGRYVIYHTGSATKTDNGMRAVSLQQLMTWKDTRWIPNDSNPNFIGIYRLNFLAR
NAM  Q8XV01_RALSO/31-241
ASQ  FAPGVRALSGWADAAAAGPGALTPEQSGVFRAWFVRIVNEQLRQGPTPRWTHRDCAGLVRFAAAEALRPHDVRWLRANGMRDAESARQLPPELDLTPAQRTLAQRWARIDGSTGAYVSALALIQQNSRFIAKDVNQALPGDLLFFDQGDDQHLMIWMDRYIAYHTGTVTRTDAGLRAVPVSELMQWKDSRWQPQGGNPNFIGVFRLAFLTR
DSQ  TTCGCGCCGGGCGTGCGGGCGCTGTCCGGCTGGGCCGACGCGGCAGCGGCGGGGCCCGGCGCGCTGACGCCCGAGCAGTCGGGGGTGTTCCGCGCGTGGTTCGTGCGCATCGTCAACGAGCAGCTGCGGCAGGGGCCCACGCCGCGCTGGACGCATCGCGACTGCGCCGGCCTGGTGCGCTTTGCCGCCGCCGAGGCGCTGCGTCCGCACGATGTCCGCTGGCTGCGCGCCAACGGCATGCGCGACGCCGAGTCGGCGCGCCAGCTGCCGCCGGAGCTCGACCTGACCCCGGCCCAGCGCACGCTCGCGCAGCGCTGGGCACGCATCGACGGCAGCACCGGCGCCTACGTCTCCGCACTGGCGCTGATCCAGCAGAACAGCCGCTTCATCGCCAAGGATGTCAACCAGGCACTGCCCGGCGACCTGCTGTTCTTCGATCAGGGCGACGACCAGCATCTGATGATCTGGATGGATCGCTACATCGCTTACCACACCGGCACCGTCACCCGCACCGACGCGGGTTTGCGGGCGGTTCCGGTTTCTGAACTGATGCAATGGAAAGACTCGCGCTGGCAGCCGCAGGGCGGCAATCCCAACTTCATCGGCGTGTTTCGCCTGGCCTTTTTGACGCGA
TRN  11011101101011011
//