EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06588 - Muskelin_N)
FAM  PF06588
PID  Muskelin_N
DES  Muskelin N-terminus
IPR  IPR010565
ANO  4
ALN  205
AID  0.403651
APH  ((YDOA_SCHPO/2-206:0.79119,Q8SWD6_ENCCU/7-197:0.88500):0.17168,MKLN1_MOUSE/12-207:0.23505,Q8MR83_DROME/44-241:0.42793);
ATP  ((YDOA_SCHPO/2-206,Q8SWD6_ENCCU/7-197),MKLN1_MOUSE/12-207,Q8MR83_DROME/44-241);
ATL  2.51085
DNO  4
DLN  615
DID  0.467035
DPH  ((Q8MR83_DROME/44-241:15.32883,Q8SWD6_ENCCU/7-197:28.02970):4.88192,YDOA_SCHPO/2-206:36.12441,MKLN1_MOUSE/12-207:6.13896);
DTP  ((Q8MR83_DROME/44-241,Q8SWD6_ENCCU/7-197),YDOA_SCHPO/2-206,MKLN1_MOUSE/12-207);
DTL  90.5101
RID  0.403651
RPH  ((YDOA_SCHPO/2-206:0.79119,Q8SWD6_ENCCU/7-197:0.88500):0.17168,MKLN1_MOUSE/12-207:0.23505,Q8MR83_DROME/44-241:0.42793);
RTP  ((YDOA_SCHPO/2-206,Q8SWD6_ENCCU/7-197),MKLN1_MOUSE/12-207,Q8MR83_DROME/44-241);
RTL  2.51085
LNK  MKLN1_MOUSE/12-207:O89050:U72194
LNK  Q8MR83_DROME/44-241:Q8MR83:AY122068
LNK  Q8SWD6_ENCCU/7-197:Q8SWD6:AL590442
LNK  YDOA_SCHPO/2-206:O13730:Z97208
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q8MR83_DROME/44-241
ASQ  LSERLNFEIYRYSSYSPNYLPENVLVDCPNDQTSRWSAYT------NSPPQFLTLKLRRPAIVKKIKFGKFEKSHVCNIKKFRVYGGLDDEHMVLLLEGGLKNDNVPEVFNLRCLTEDGS-ENLPILYLKIVPLLSWGPSFNFSIWYVELHGQDDPMYTSARMKNYNSLREVEIIKLCLKHFRQQGYLSAFGALQEQTNVQLEHP
DSQ  CTTTCCGAGCGCCTGAACTTTGAGATCTACCGTTACTCCAGCTACTCGCCAAACTATCTGCCTGAAAACGTCCTGGTGGACTGTCCCAACGACCAAACATCTAGGTGGTCCGCCTACACG------------------AACAGCCCGCCGCAATTTCTCACCTTGAAGCTGCGCCGTCCCGCCATTGTGAAGAAAATCAAGTTTGGCAAGTTCGAGAAATCGCATGTGTGCAACATCAAGAAATTCCGTGTTTACGGCGGCTTGGACGATGAGCACATGGTTTTGCTGCTGGAGGGTGGCCTAAAAAACGATAACGTGCCAGAAGTATTCAACCTGCGCTGCCTGACCGAAGACGGTTCG---GAAAATCTACCAATACTGTACCTCAAGATCGTGCCCCTGCTCTCCTGGGGTCCGTCGTTCAACTTCAGCATTTGGTACGTGGAGCTGCACGGCCAGGACGACCCCATGTACACCAGTGCTCGCATGAAGAACTACAACTCGCTGCGCGAGGTGGAGATCATCAAGCTGTGTCTGAAGCACTTCCGCCAGCAGGGCTATTTGAGTGCCTTTGGGGCGCTCCAGGAGCAAACGAATGTGCAACTGGAGCACCCG
TRN  10010101100011011
NAM  MKLN1_MOUSE/12-207
ASQ  ECRLLPYALHKWSSFSSTYLPENILVDKPNDQSSRWSSES------NYPPQYLILKLERPAIVQNITFGKYEKTHVCNLKKFKVFGGMNEENMTELLSSGLKNDYNKETFTLKHKIDE---QMFPCRFIKIVPLLSWGPSFNFSIWYVELSGIDDPDIVQPCLNWYSKYREQEAIRLCLKHFRQHNYTEAFESLQKKTKIALEHP
DSQ  GAGTGCCGGCTTCTGCCCTACGCGCTGCATAAGTGGAGCTCCTTCTCCTCCACCTACCTTCCCGAGAACATTTTAGTGGATAAACCAAATGATCAGTCTTCCAGATGGTCTTCAGAGAGC------------------AACTATCCTCCCCAATACTTGATTCTGAAGCTTGAAAGGCCTGCTATCGTTCAGAATATTACATTTGGAAAATATGAGAAAACTCATGTCTGCAATTTGAAGAAATTCAAAGTTTTTGGTGGAATGAATGAAGAAAATATGACAGAGCTGTTGTCCAGTGGCCTGAAGAATGATTATAACAAAGAGACATTTACCTTGAAACATAAAATTGATGAA---------CAGATGTTCCCTTGTCGATTCATTAAAATTGTTCCACTTTTGTCCTGGGGGCCCAGCTTTAACTTTAGCATCTGGTATGTTGAACTTAGTGGCATTGATGATCCTGATATCGTGCAGCCCTGTCTGAACTGGTACAGCAAGTACCGTGAACAGGAAGCCATTCGCCTTTGCCTAAAACACTTCAGACAACATAACTATACAGAGGCTTTTGAATCCCTGCAGAAGAAAACCAAGATTGCACTGGAACATCCA
TRN  10010101100011000
NAM  YDOA_SCHPO/2-206
ASQ  ERKELSYTIQSWSSYSGAFHPINILIDNPHQANSRWSCNTSICKPNNSEEQYVILKLDKLALVTDITFGKFHTPHLCNLKDFIVYGGREQHLMFPLLRAGLTNDSNRETFPLCIKKYNKIENSIACKYIKIVPLQAHAHEFNMSIWYVALHGIDSASALSCTEKNRALHLEKKALNCLLSYFAFKGKLDICSVILQSYQLSIPHS
DSQ  GAACGTAAAGAATTGTCTTATACCATTCAAAGCTGGTCCAGCTATTCTGGAGCATTTCATCCTATCAATATACTTATCGATAATCCACACCAGGCTAACAGCCGATGGAGCTGTAATACTTCAATATGTAAACCCAACAACTCTGAAGAACAGTATGTAATTCTGAAACTTGATAAACTTGCGTTGGTTACCGATATCACCTTTGGGAAATTCCACACTCCCCATCTTTGCAACCTTAAAGATTTTATAGTATATGGGGGGCGTGAACAGCATTTGATGTTCCCTTTATTAAGAGCTGGATTGACAAATGATTCAAATCGAGAAACATTTCCATTGTGTATCAAGAAATATAACAAAATTGAGAATTCAATTGCTTGTAAGTATATCAAAATTGTTCCACTTCAAGCTCATGCTCATGAATTTAACATGAGTATATGGTATGTTGCTTTACACGGCATTGACTCAGCCAGCGCTTTATCATGCACAGAGAAGAACAGAGCTTTACATCTAGAAAAAAAGGCACTCAATTGCCTTCTCTCTTACTTTGCTTTTAAAGGGAAACTTGATATATGTTCTGTGATACTTCAAAGCTACCAGCTTTCCATACCACATTCA
TRN  10010101100011000
NAM  Q8SWD6_ENCCU/7-197
ASQ  LYSVIPYEIHSYSTYASVYVPNNIKRNDPMDPNSRWSTST------NDHLQYIVLKVPTSLVV-TITFGKYNKMHVSNVKKMRISVSRDGVEYREVLCGGLKNDSEMETFNLLVKD----EIYFIAQYVKIEPLAAWGVNFSYSLWFVELRGLVD---VEEFVRYNEMVVFGRSMRNCLRFLRDCGFRDIYEILEKRSSDKIEDE
DSQ  CTATACAGCGTGATTCCTTACGAGATCCACAGCTACTCGACATATGCCTCTGTATATGTCCCAAACAATATCAAAAGAAATGACCCCATGGACCCCAACTCAAGATGGTCGACATCAACC------------------AATGACCATCTGCAGTACATCGTCCTGAAGGTTCCTACGAGTCTTGTTGTT---ACCATTACGTTTGGGAAGTACAATAAGATGCATGTGTCCAATGTCAAGAAGATGAGGATAAGCGTTTCCAGGGACGGTGTTGAGTACAGAGAAGTTTTGTGCGGAGGGTTGAAAAACGATTCCGAGATGGAAACTTTCAACCTCCTTGTGAAGGAC------------GAGATATACTTTATTGCCCAGTATGTGAAGATCGAGCCTCTTGCTGCATGGGGAGTCAACTTCAGCTACTCTCTGTGGTTTGTCGAGCTTAGGGGGCTTGTGGAC---------GTCGAGGAGTTTGTCCGCTACAACGAAATGGTTGTCTTTGGAAGGTCGATGAGAAACTGCTTGAGATTTCTCCGCGACTGCGGATTCAGAGACATCTACGAGATCCTCGAGAAAAGAAGCTCAGACAAAATTGAGGATGAG
TRN  10010101100011001
//